Momordica charantia (bitter melon): 111015000 Help Entry 111015000         CDS       T05045                                  Name (RefSeq) dynein light chain-like   KO K10418   dynein light chain LC8-type Organism mcha  Momordica charantia (bitter melon) Pathway mcha04814   Motor proteins Brite KEGG Orthology (KO) [BR:mcha00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     111015000  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mcha03037]     111015000    04812 Cytoskeleton proteins [BR:mcha04812]     111015000 Cilium and associated proteins [BR:mcha03037]  Motile cilia and associated proteins   Dynein arm    111015000 Cytoskeleton proteins [BR:mcha04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      111015000 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  111015000 NCBI-ProteinID:  XP_022145583 UniProt:  A0A6J1CWC6 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MLEGKAAVRETDMPEGIQSHVLELAYKALDHHEVSDCQSIARFIKQRFDEAYGPAWHCVV GKAFGGCITHLCGSFIFFHVDIMEFLIFKDGRDFSKSIEETLGVRQKS NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgttggagggcaaagctgcggtccgcgaaacagacatgccagaggggatccagagccat gtccttgagttggcttataaagcacttgatcatcacgaagtttccgactgtcaatccatt gcccgttttatcaaacagagatttgacgaagcttatggcccggcatggcactgtgttgtg ggaaaagcttttggaggttgcattacacatttgtgtgggagtttcatcttcttccatgtg gatataatggagtttctcatcttcaaggacggaagagacttctccaaaagcattgaagaa accttaggagtgcgccagaaaagttaa

DBGET integrated database retrieval system