Momordica charantia (bitter melon): 111016526 Help Entry 111016526         CDS       T05045                                  Name (RefSeq) calmodulin-7-like   KO K02183   calmodulin Organism mcha  Momordica charantia (bitter melon) Pathway mcha04016   MAPK signaling pathway - plant mcha04070   Phosphatidylinositol signaling system mcha04075   Plant hormone signal transduction mcha04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mcha00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     111016526    04070 Phosphatidylinositol signaling system     111016526    04075 Plant hormone signal transduction     111016526  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     111016526  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcha01009]     111016526   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mcha04131]     111016526    03036 Chromosome and associated proteins [BR:mcha03036]     111016526   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcha04147]     111016526 Protein phosphatases and associated proteins [BR:mcha01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111016526 Membrane trafficking [BR:mcha04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111016526 Chromosome and associated proteins [BR:mcha03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111016526 Exosome [BR:mcha04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111016526 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  111016526 NCBI-ProteinID:  XP_022147657 UniProt:  A0A6J1D2Z3 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAEQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKIMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagctcaccgacgatcagatctccgagttcaaggaggccttcagcctcttc gacaaggacggcgatggttgcatcacgactaaggagcttgggaccgtgatgaggtcactt ggccagaacccaactgaagccgagctgcaggacatgatcaacgaggtggatgctgatgga aacggaacaatcgacttccccgagttcctgaacctgatggctcggaagatgaaggacact gactcagaggaggaactcaaggaagccttccgtgtgtttgacaaggaccaaaatgggttc atttctgcagctgagctccgccacgtgatgacaaatctcggcgagaaattgaccgatgaa gaagtcgatgagatgatccgtgaggctgatgttgacggtgatggccagattaactacgag gaattcgttaaaatcatgatggccaagtga

DBGET integrated database retrieval system