Momordica charantia (bitter melon): 111020514 Help Entry 111020514         CDS       T05045                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mcha  Momordica charantia (bitter melon) Brite KEGG Orthology (KO) [BR:mcha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mcha03041]     111020514   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcha04052]     111020514 Spliceosome [BR:mcha03041]  Complex B   Other components    Complex B specific factors     111020514 Cytokines and neuropeptides [BR:mcha04052]  Neuropeptides   Unclassified    111020514 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  111020514 NCBI-ProteinID:  XP_022152891 UniProt:  A0A6J1BXR9 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgatcgtctcgggaagaaggttcgggtaaagtgcaacgaa gacgacacgatcggagacttgaagaagctcgtcgctgctcagaccggaaccagggccgag aagatcaggatccagaagtggtacaacatctacaaggatcacatcacgctcaaggattac gagatccatgacggcatgggactcgagctctattacaattga

DBGET integrated database retrieval system