Mycobacterium intracellulare subsp. chimaera: AN480_12205
Help
Entry
AN480_12205 CDS
T04926
Name
(GenBank) PPE family protein
Organism
mchi
Mycobacterium intracellulare subsp. chimaera
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PPE
PPE-PPW
Motif
Other DBs
NCBI-ProteinID:
AOS92043
LinkDB
All DBs
Position
2683773..2685425
Genome browser
AA seq
550 aa
AA seq
DB search
MTAPIFAAFPPEVHSTLLSSGPGPAPLLAAATAWSSMSTDYATAAAELSGLLGAVQAGAW
DGPSADQYVAAHVPYQAWLAESAAKSATAASLHETAATAYTAALAAMPTMGELTANHAVH
GALVATNFFGINTIPIAVNEADYARMWVQAATTMTTYQAVSESALAAVPPTTPAPPIVVP
GAEAGTAGAAAMQAAAVAPATDSGSNLNNADTSSAQQQATTTTQYPSWMDQLTKWLQQYT
QNFAWPVSKDLNPGGWPFPPVPWVNSLASFFGQLGLSPALSTALGWAIFHTLMIFWPFIQ
LAIQMAVVLAPVVVAAIGAAAAGGAAAAVTAISVGIPLASAPPLPAVAAAPAPVVAPAPT
IATAPASVSHVSAPSTAPATTVAGSAGGGPVGGGPGVGFGPTATDGIGAGLSNALYAVGL
SGLSARSSASSRSRRKSEEPSSDDLDAPAGAAAAAAAKKKARARRRRGGTATERAYRYEF
MDLDQDLDPGVDAEDPDAARPSEDSAGPLGFAGAAAKSDAARAAGLATLTRDGFSDGPSM
PMMPSTWDRD
NT seq
1653 nt
NT seq
+upstream
nt +downstream
nt
atgaccgccccgatctttgccgcgtttccgcccgaagtgcactcgaccttgctcagcagc
ggccccggccccgccccgctgctggccgcggcgacggcatggtcgtcgatgagcaccgac
tacgcgaccgcggcggccgagctcagcgggttgctgggcgccgtgcaggccggcgcgtgg
gacgggcccagcgccgaccagtacgtggccgcgcacgttccctaccaggcctggctggcg
gagagcgcggccaagagcgcgaccgcggccagcctgcacgagaccgcggccaccgcctac
accgccgcgttggccgccatgcccacgatgggcgaactcacggcaaaccacgcggtgcac
ggggcgctcgtcgccacgaacttcttcggcatcaacaccatcccgatcgccgtcaacgaa
gccgattacgcgcgcatgtgggtgcaggccgcgacgacgatgaccacctaccaggccgtt
agcgaatccgccctggccgcggtcccgccgaccactcccgcgccgccgatcgtcgtcccg
ggcgcggaggcggggaccgccggcgccgcggcgatgcaagcggccgccgtggcgccggcg
acggattccggctccaacctcaacaatgccgacacctcgagcgcccagcagcaggccacc
accacgacgcagtacccgtcctggatggaccagctgaccaagtggctgcagcagtacacc
cagaatttcgcgtggccggtgtccaaggacctcaaccccggtgggtggccgttcccgccg
gtgccgtgggtcaacagtctcgcctcgttcttcgggcagctgggactgtctccggcgctg
tcgacggcgctgggttgggccatcttccacaccttgatgatcttctggccgtttatccag
ctggcgatccagatggccgtggtgctggcgccggtcgtcgttgccgccatcggcgcggcc
gcggccggtggggcggctgcggcggtcaccgcgatcagcgtcgggatcccgctcgcgtct
gccccgcccctgccggccgtcgcggcggcgcccgcaccggtggttgctccggcgccgacg
attgccaccgcgcccgccagtgtcagccacgtgtcggcaccgtccaccgcccccgcgacg
acggttgccgggtcggccggcggcggaccggtcggtggcggacccggggtgggtttcggt
ccgacggcgaccgacggaatcggcgcgggcctctccaacgccctgtatgcggtggggttg
tcgggactgtcggcgcgcagcagcgcgagcagccggtcacggcgcaagtcggaggagccg
tcctcggacgacctcgacgcgcccgccggcgcggccgctgccgccgcagccaagaagaag
gcccgggcccgtcggcgccgcggcggaaccgccaccgaacgcgcctaccgctacgaattc
atggacctggaccaggatttggatccgggcgttgatgcagaggatccggacgccgcacgg
ccctccgaggacagtgcggggccgctcggattcgccggtgccgcagccaaatccgacgcg
gcccgggccgccggattggcgacgctgacccgggacggattcagcgacggtcccagcatg
ccgatgatgccgagcacctgggaccgcgactag
DBGET
integrated database retrieval system