Methanoculleus chikugoensis: MchiMG62_00530 Help Entry MchiMG62_00530    CDS       T07488                                  Name (GenBank) hypothetical protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mchk  Methanoculleus chikugoensis Pathway mchk00010   Glycolysis / Gluconeogenesis mchk00020   Citrate cycle (TCA cycle) mchk00620   Pyruvate metabolism mchk00633   Nitrotoluene degradation mchk00640   Propanoate metabolism mchk00650   Butanoate metabolism mchk00680   Methane metabolism mchk00720   Other carbon fixation pathways mchk01100   Metabolic pathways mchk01110   Biosynthesis of secondary metabolites mchk01120   Microbial metabolism in diverse environments mchk01200   Carbon metabolism mchk01210   2-Oxocarboxylic acid metabolism Module mchk_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA mchk_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mchk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MchiMG62_00530    00020 Citrate cycle (TCA cycle)     MchiMG62_00530    00620 Pyruvate metabolism     MchiMG62_00530    00640 Propanoate metabolism     MchiMG62_00530    00650 Butanoate metabolism     MchiMG62_00530   09102 Energy metabolism    00720 Other carbon fixation pathways     MchiMG62_00530    00680 Methane metabolism     MchiMG62_00530   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MchiMG62_00530 Enzymes [BR:mchk01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MchiMG62_00530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_8 Fer4_16 Fer4_17 Fer4_15 Fer4_4 Fer4_22 Fer4_3 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  BBL66872 LinkDB All DBs Position 57859..58104 Genome browser AA seq 81 aa AA seqDB search MRERLALSRPKEAASGKTGTWRTFRPVVDKETCNACGLCAQYCPDGVIDEELNIDLDYCK GCGICANECPKGAIAMVREER NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagagagagacttgcgctcagcaggccgaaggaggccgcgtcggggaagaccgggacg tggcggacgttccggcccgtcgtggataaggagacgtgcaacgcctgcgggctctgcgcc cagtactgcccggacggggtcatcgacgaggaactgaacatcgacctcgactactgcaag gggtgcggcatctgcgcgaacgagtgcccgaaaggggcgatcgctatggtgcgggaggag cgctga

DBGET integrated database retrieval system