Methanoculleus chikugoensis: MchiMG62_05380 Help Entry MchiMG62_05380    CDS       T07488                                  Name (GenBank) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism mchk  Methanoculleus chikugoensis Pathway mchk03060   Protein export mchk04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mchk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MchiMG62_05380    04141 Protein processing in endoplasmic reticulum     MchiMG62_05380  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MchiMG62_05380  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mchk04131]     MchiMG62_05380   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mchk02044]     MchiMG62_05380 Membrane trafficking [BR:mchk04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MchiMG62_05380 Secretion system [BR:mchk02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MchiMG62_05380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-ProteinID:  BBL67357 LinkDB All DBs Position 522930..523139 Genome browser AA seq 69 aa AA seqDB search MMDYKETLKEVKSFKIEEELFKKYWRVLKLARTPTRDEFSKIAIVAAAGIMLIGLVGFII YEIMLVLPK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgatggattataaagagacgttgaaggaagtaaagtcgttcaagatcgaggaggaactc ttcaaaaagtactggcgggtgctgaaactggcacggacgccgacccgcgacgagttctcc aagatcgccattgtggcggcggccgggatcatgctcatcggccttgtcggctttatcata tacgagatcatgctggtactgcccaaatga

DBGET integrated database retrieval system