Methanoculleus chikugoensis: MchiMG62_06980 Help Entry MchiMG62_06980    CDS       T07488                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism mchk  Methanoculleus chikugoensis Pathway mchk03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:mchk00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     MchiMG62_06980  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mchk03009]     MchiMG62_06980    03016 Transfer RNA biogenesis [BR:mchk03016]     MchiMG62_06980    03029 Mitochondrial biogenesis [BR:mchk03029]     MchiMG62_06980 Enzymes [BR:mchk01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      MchiMG62_06980 Ribosome biogenesis [BR:mchk03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      MchiMG62_06980 Transfer RNA biogenesis [BR:mchk03016]  Eukaryotic type   5'processing factors    Ribonucrease P     MchiMG62_06980 Mitochondrial biogenesis [BR:mchk03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     MchiMG62_06980 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 Motif Other DBs NCBI-ProteinID:  BBL67517 UniProt:  A0ABM7H476 LinkDB All DBs Position 681704..681976 Genome browser AA seq 90 aa AA seqDB search MISPQNVLRHELIGLDVLVVRASNPGHAGVSGRVTDETRNTLVILTGRGEKQIPKRFSVF RFRLPDGTTVDVDGSSLEAQPERRIGMRIR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgatctctccccagaacgtccttcgccacgagttgatcgggctggacgttctggtggtc cgtgcgagcaacccgggtcatgccggggtatcgggtcgcgtcactgatgagacccgaaat accctggtcatcctgaccgggcggggagaaaagcagataccaaaacggttcagcgtgttc cgcttccggcttcccgacggcacgaccgtcgacgtcgacgggtcgagcctcgaagcacag ccggaacggcggatcggcatgcgcatcagataa

DBGET integrated database retrieval system