Methanoculleus chikugoensis: MchiMG62_22220 Help Entry MchiMG62_22220    CDS       T07488                                  Name (GenBank) histone   KO K24450   DNA-binding protein Organism mchk  Methanoculleus chikugoensis Brite KEGG Orthology (KO) [BR:mchk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mchk03036]     MchiMG62_22220 Chromosome and associated proteins [BR:mchk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     MchiMG62_22220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TFIID-31kDa Bromo_TP TAF CENP-S V-ATPase_G_2 LonB_AAA-LID TFIID_20kDa DUF4239 Motif Other DBs NCBI-ProteinID:  BBL69041 LinkDB All DBs Position complement(2256593..2256802) Genome browser AA seq 69 aa AA seqDB search MTDIPLAPVGRIVKKSGAERVSSDANEELAKLMEQYASRIAKEAIKLAGHAGRKTVKATD VRMAAETVK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgactgatatacctctggcacctgttggcagaatcgtaaagaaatccggcgcggagcgg gtgagttccgatgccaatgaagaactcgcgaagttgatggagcagtatgcctcaaggatc gcgaaagaggcgatcaagctggcgggtcacgcgggcaggaagacggtcaaggcaaccgat gtccggatggcggcagaaaccgtgaaataa

DBGET integrated database retrieval system