Methanoculleus chikugoensis: MchiMG62_25650 Help Entry MchiMG62_25650    CDS       T07488                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mchk  Methanoculleus chikugoensis Pathway mchk03010   Ribosome Brite KEGG Orthology (KO) [BR:mchk00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MchiMG62_25650   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MchiMG62_25650  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mchk03011]     MchiMG62_25650    04121 Ubiquitin system [BR:mchk04121]     MchiMG62_25650   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mchk04147]     MchiMG62_25650 Ribosome [BR:mchk03011]  Ribosomal proteins   Eukaryotes    Small subunit     MchiMG62_25650   Archaea     MchiMG62_25650 Ubiquitin system [BR:mchk04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MchiMG62_25650 Exosome [BR:mchk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MchiMG62_25650   Exosomal proteins of colorectal cancer cells    MchiMG62_25650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 MqsA_antitoxin Zn_ribbon_Nudix Auto_anti-p27 Rcat_RNF216 Cas12f1-like_TNB MliC Zn_ribbon_NOB1 DUF1451 Ribosomal_L37e DUF1936 Zn_ribbon_13 Zn_ribbon_RPB9 Miga Motif Other DBs NCBI-ProteinID:  BBL69384 UniProt:  A0A1M4MM71 LinkDB All DBs Position 2613398..2613577 Genome browser AA seq 59 aa AA seqDB search MAAKKQVSAKGKRYECYEVKGDTAVLQKRHCPRCGPGVLMAAHKDRVACGKCGYTEFQK NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atggcagccaagaagcaggtctcggccaagggcaagagatacgagtgctacgaagtcaag ggcgatacggcggtcctgcagaagcggcactgcccccggtgcggccccggcgtactgatg gccgcgcacaaggaccgggtagcctgcggcaagtgcggctacaccgagttccagaagtag

DBGET integrated database retrieval system