Micromonospora chalcea: PVK74_02940
Help
Entry
PVK74_02940 CDS
T08919
Name
(GenBank) SDR family NAD(P)-dependent oxidoreductase
Organism
mchl
Micromonospora chalcea
Pathway
mchl00600
Sphingolipid metabolism
mchl04382
Cornified envelope formation
Brite
KEGG Orthology (KO) [BR:
mchl00001
]
09100 Metabolism
09103 Lipid metabolism
00600 Sphingolipid metabolism
PVK74_02940
09150 Organismal Systems
09158 Development and regeneration
04382 Cornified envelope formation
PVK74_02940
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short
adh_short_C2
KR
Epimerase
SDR
Motif
Other DBs
NCBI-ProteinID:
WDQ00761
LinkDB
All DBs
Position
complement(633247..634119)
Genome browser
AA seq
290 aa
AA seq
DB search
MTTTAETRTWIITGASSGLGLGLAEAALQAGEHVIGTARRADRFDGLKARYGDGLLAVAH
DVRDTAGAAGVVQRALEVFGRVDVLVNNAGAGQVGAAEEITDAALRAMLEQHLFGPAAYV
RAVLPHMRERRSGAVVQMSSQGGRMSFPAVGSYSAGKFALEGWSEALAGEVAPFGIRVLI
VEPSRFRTAFNAADVLNTARQSSIYEGVTGAVRANMEGADGIQEGDPARAARVIRNMLDT
PDAPLRLPLGAEAVRNLTRAYRAALDDVEKWASVSESADFPGMPPAVRPF
NT seq
873 nt
NT seq
+upstream
nt +downstream
nt
gtgaccacgacagccgagacgagaacatggatcatcacgggcgcgagttccggcctcggt
ctggggctcgccgaggcggcactccaggctggcgagcatgtgatcggcaccgcgcgacgg
gccgaccgctttgacgggctcaaggcgcggtacggggatgggctcctcgccgtcgcgcac
gatgtgcgcgacacggccggagcggccggggtcgtgcagcgggcgctggaggtgttcggg
cgcgtcgacgtgctcgtcaacaatgcaggcgccggacaggtcggcgccgccgaagagatc
acggacgctgctctgcgggccatgctcgagcagcacctgttcggcccggccgcctacgtg
cgtgccgtgctgccccacatgagggaacgtcgctctggtgcggtcgtgcagatgagcagc
cagggcgggcggatgtcgtttcccgccgtcggcagctactcagccggcaagttcgcgctc
gagggctggtcggaggcgctggcgggcgaggtcgcaccgttcggcatccgcgtcctcatc
gtcgagcccagtcgattccgcaccgcgttcaacgccgcggacgtgctcaacacagcgcgg
cagagctcgatctacgagggggtcaccggtgccgtgcgcgcgaacatggagggagccgac
ggcatccaggagggcgacccggcacgagccgcccgggtgatccggaacatgctcgacaca
cccgacgcgccgctccggctcccgctcggcgccgaggcggttcgcaacctcacccgcgcc
taccgtgcagcgctcgacgacgtcgagaagtgggcgtcggtgagcgagtcggcggacttc
ccaggtatgccgcccgcggttcgcccgttctga
DBGET
integrated database retrieval system