Micromonospora chalcea: PVK74_16680 Help Entry PVK74_16680       CDS       T08919                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mchl  Micromonospora chalcea Brite KEGG Orthology (KO) [BR:mchl00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     PVK74_16680 Enzymes [BR:mchl01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      PVK74_16680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_2 Thioredoxin GST_N Motif Other DBs NCBI-ProteinID:  WDP97552 LinkDB All DBs Position 3827384..3827626 Genome browser AA seq 80 aa AA seqDB search MLTMYSTPWCGYCHRLKSQLDREGIAYEVVDIEQDPAAADFVMSVNGGNQTVPTLRFADG SALTNPSINQVKQHLAALPG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgacgatgtattccaccccgtggtgcggctactgccaccggctgaagtcgcagctc gaccgggagggcatcgcgtacgaggtggtcgacatcgagcaggaccccgcggccgcggac ttcgtgatgagcgtcaacggcggcaaccagaccgtcccgacgctgcgcttcgccgacggc agcgccctgaccaacccctcgatcaaccaggtcaagcagcacctggccgcgctgcccggc tga

DBGET integrated database retrieval system