Mesorhizobium ciceri CC1192: A4R28_08045 Help Entry A4R28_08045       CDS       T08712                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mcic  Mesorhizobium ciceri CC1192 Pathway mcic02024   Quorum sensing mcic03018   RNA degradation Brite KEGG Orthology (KO) [BR:mcic00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     A4R28_08045  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     A4R28_08045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mcic03019]     A4R28_08045    03036 Chromosome and associated proteins [BR:mcic03036]     A4R28_08045 Messenger RNA biogenesis [BR:mcic03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      A4R28_08045 Chromosome and associated proteins [BR:mcic03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     A4R28_08045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AMX93044 UniProt:  A0AB38T4A3 LinkDB All DBs Position complement(1674977..1675222) Genome browser AA seq 81 aa AA seqDB search MAERSQNLQDLFLNSVRKSKNPLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPSQPVQMFDGEESQGA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgatcgcaaaaccttcaggacctgttcctgaattcagttcgcaagagcaag aacccgctcaccatcttcctcatcaacggcgtgaagctgaccggcgtggtcacttcgttc gacaatttctgtgtcctgctgcgccgcgatggtcactcccagctcgtctacaagcacgcc atttccacgatcatgccgagccagccggttcagatgttcgatggcgaggaaagccagggc gcctga

DBGET integrated database retrieval system