Melitaea cinxia (Glanville fritillary): 123657810 Help Entry 123657810         CDS       T09237                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mcix  Melitaea cinxia (Glanville fritillary) Pathway mcix04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mcix00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     123657810  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mcix04121]     123657810    03400 DNA repair and recombination proteins [BR:mcix03400]     123657810 Ubiquitin system [BR:mcix04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      123657810    Cul5 complex      123657810 DNA repair and recombination proteins [BR:mcix03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      123657810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  123657810 NCBI-ProteinID:  XP_045449277 LinkDB All DBs Position 11:complement(2378176..2389323) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFETLELTPYSTPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgattaggcgaaaaaaattgaccatctttacggacgccaaggac acgacaactgttttagaattgaagaaaatgattgaaggaatcctcaaagtaccaccacca agtcagatgcttttcaacaaggacagccagctaatggaagatgagaagaccctcgctgaa tatggactcacttcggctactgctaaggctcaatgccctgctccgattggtttggcttta aggaaagagaatggagaatttgagacattggaactgacaccatactccacaccaccagat ctaccagacgtcatgaaatcccaggagactaatggacaggaacagatggatcagcactaa

DBGET integrated database retrieval system