Methanothrix soehngenii: MCON_1917 Help Entry MCON_1917         CDS       T01468                                  Name (GenBank) conserved hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mcj  Methanothrix soehngenii Pathway mcj03010   Ribosome Brite KEGG Orthology (KO) [BR:mcj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MCON_1917   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MCON_1917  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mcj03011]     MCON_1917    04121 Ubiquitin system [BR:mcj04121]     MCON_1917 Ribosome [BR:mcj03011]  Ribosomal proteins   Eukaryotes    Large subunit     MCON_1917   Archaea     MCON_1917 Ubiquitin system [BR:mcj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MCON_1917 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 Zn_ribbon_RPAB4 Ribosomal_L37e Zn_ribbon_LapB Zn_ribbon_RanBP DUF6079 DUF7577 Motif Other DBs NCBI-ProteinID:  AEB68496 UniProt:  F4BW66 LinkDB All DBs Position complement(1640545..1640694) Genome browser AA seq 49 aa AA seqDB search MARFPEAENRILNLKICMRCNARNPVKATRCRKCGYEGLRMKSKENKTA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctagatttccagaagcagaaaacagaatcttgaacctcaagatatgcatgcgctgc aatgcgcgaaacccagtaaaagctacacgctgccgcaaatgcggctatgaaggcctgcgg atgaagtccaaggagaacaagaccgcttag

DBGET integrated database retrieval system