KEGG   Macrococcus caseolyticus: MCCL_0602
Entry
MCCL_0602         CDS       T00848                                 
Name
(GenBank) conserved hypothetical protein
  KO
K05519  transcriptional activator of comK gene
Organism
mcl  Macrococcus caseolyticus
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcl03000]
    MCCL_0602
Transcription factors [BR:mcl03000]
 Prokaryotic type
  Other transcription factors
   Others
    MCCL_0602
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: BAH17309
UniProt: B9EAP8
LinkDB
Position
644699..645700
AA seq 333 aa
MNYKAISLATLCALIVLCIYSFIPKHQEIRSVAYLSKESVHDQTWGTEGYKGILNIIQTY
DANFFIQENLKSDKAVMDTIRQFAERDVNIIYGQSSEFESVFNLAAVKYPKMHFVFLNGE
SRAKNVSSLNIEGYAMGFFGGMLAAHESKTKVLGIIGAFKGQPEIDGFIDGAHYEEKSAK
VKTKYIKTWGYNGDAQACTIGLIDKEHADVIYPAADGTNRDVMEIVKARNKKAIGYISDQ
SYLGDFVIGSTTQNISKLYLDIADDYYEQRLKGGTQKYGMKNNITDLKISKSVDEVYVKK
LKTDIQRFKMTGILPNKKVPPTYQDGAYLIKTA
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaattataaagcaatctccttagcaacgctctgcgcacttattgtcctatgtatctat
tcttttattccaaaacatcaggagattaggagtgtcgcttatttatcgaaagaatcagtt
catgaccagacatggggcacagaagggtataaagggatattaaatattatccagacgtat
gatgcgaacttctttatccaggagaatctaaagtcagacaaggccgtaatggatacgatt
cgtcaatttgctgaacgcgatgtcaatattatatacgggcaaagttctgaatttgaatca
gtatttaacctggctgcagtgaagtatccgaagatgcattttgtctttttaaatggtgag
agtcgtgccaaaaatgtatcttccttaaatatagaaggatatgcgatgggatttttcgga
ggaatgctcgcggcacatgagtctaaaacgaaggtgcttggcattatcggggcatttaaa
ggacagccagagatagatggatttatagatggcgcccattatgaagagaaatctgctaaa
gttaaaacaaagtatataaagacatggggatataatggggatgcacaagcatgtacaata
gggttgattgataaggagcatgcagatgtgatctatccagcagcagacgggacaaatcga
gatgtaatggagattgttaaagcccgtaataagaaggctatcggttatatctctgatcaa
agttacttaggagactttgttattggtagtacgacgcagaatatatcgaaattatattta
gatattgctgacgattactatgaacaaaggcttaaaggtggcacccaaaaatacggaatg
aagaacaacatcactgatcttaagatatcgaaatctgtagatgaagtgtatgttaagaag
ctcaaaacagatatacagagatttaaaatgacaggcattcttcctaacaagaaagtaccc
ccgacatatcaggatggtgcgtatctaattaaaacagcctaa

DBGET integrated database retrieval system