Macrococcoides caseolyticum: MCCL_0690 Help Entry MCCL_0690         CDS       T00848                                  Name (GenBank) conserved hypothetical protein   KO K23264   phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3] Organism mcl  Macrococcoides caseolyticum Pathway mcl00230   Purine metabolism mcl01100   Metabolic pathways mcl01110   Biosynthesis of secondary metabolites Module mcl_M00048   De novo purine biosynthesis, PRPP + glutamine => IMP Brite KEGG Orthology (KO) [BR:mcl00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     MCCL_0690 Enzymes [BR:mcl01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor     6.3.5.3  phosphoribosylformylglycinamidine synthase      MCCL_0690 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PurS DUF3333 DUF5825 Motif Other DBs NCBI-ProteinID:  BAH17397 UniProt:  B9EAY6 LinkDB All DBs Position 742227..742487 Genome browser AA seq 86 aa AA seqDB search MTKIELHITLQPQVLDTQGQTLTRAVHDLGYTQVNDIRVGKVLYMTVDEASEQAVANVVN TLSEKLFANTVIEEYSYKIVEDEETK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgactaaaatcgaattacacatcacattacaaccacaggtattagacacacaaggacaa acgttaacacgtgcggtacatgatctgggctacactcaagtcaacgatattcgcgtaggt aaagtattatatatgacggttgacgaagcgagcgaacaggccgttgcaaacgtagtcaat acattaagtgagaagttatttgcgaacactgtaatcgaagaatacagctacaaaattgtt gaagatgaggagacgaaataa

DBGET integrated database retrieval system