Metamycoplasma cloacale: DK849_02115 Help Entry DK849_02115       CDS       T06147                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism mclo  Metamycoplasma cloacale Brite KEGG Orthology (KO) [BR:mclo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mclo03032]     DK849_02115    03036 Chromosome and associated proteins [BR:mclo03036]     DK849_02115    03400 DNA repair and recombination proteins [BR:mclo03400]     DK849_02115 DNA replication proteins [BR:mclo03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DK849_02115 Chromosome and associated proteins [BR:mclo03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DK849_02115 DNA repair and recombination proteins [BR:mclo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DK849_02115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AWX42849 UniProt:  A0A2Z4LM77 LinkDB All DBs Position 479575..479853 Genome browser AA seq 92 aa AA seqDB search MNKKQLITKTSEVTGHSQVLIETIFNHMQAIIAEELAKEEKVSISGFGTFSAVKKEEKER ENYFTKQKIVVAAKIEPKFKFSSVFKDELNKN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaaaacaattaatcactaaaaccagcgaagtaactggtcactcacaagtttta attgaaaccatctttaatcacatgcaagcaattatcgctgaagaacttgcaaaagaagaa aaagtttcaatttcaggttttggtacattttctgcagtgaaaaaagaagaaaaagaacgt gaaaattacttcacaaaacaaaaaattgttgttgctgcaaaaattgaacctaaatttaaa ttttcatctgtattcaaagatgaattaaacaaaaattaa

DBGET integrated database retrieval system