KEGG   Metallosphaera cuprina: Mcup_0544
Entry
Mcup_0544         CDS       T01467                                 
Name
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00220  Arginine biosynthesis
mcn00250  Alanine, aspartate and glutamate metabolism
mcn00270  Cysteine and methionine metabolism
mcn00330  Arginine and proline metabolism
mcn00350  Tyrosine metabolism
mcn00360  Phenylalanine metabolism
mcn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcn00401  Novobiocin biosynthesis
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01210  2-Oxocarboxylic acid metabolism
mcn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mcup_0544
   00270 Cysteine and methionine metabolism
    Mcup_0544
   00220 Arginine biosynthesis
    Mcup_0544
   00330 Arginine and proline metabolism
    Mcup_0544
   00350 Tyrosine metabolism
    Mcup_0544
   00360 Phenylalanine metabolism
    Mcup_0544
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mcup_0544
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Mcup_0544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcn01007]
    Mcup_0544
Enzymes [BR:mcn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Mcup_0544
Amino acid related enzymes [BR:mcn01007]
 Aminotransferase (transaminase)
  Class I
   Mcup_0544
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AEB94651
UniProt: F4G0N2
LinkDB
Position
496967..498157
AA seq 396 aa
MENYSRSLSRLTGESTLLYQEIARNVERTKGIKTINFGIGQPDLPTPKRIREEAKSALDK
GFTAYTPALGLDELRSRVAEFLSQRYGDNIVKDEVAITPGAKTALFLAFLTYVNPGDEVI
LFDPSFYSYAEVVNLLGGKPVYVPIRFDSDRGFYVDVNDVVSRISSKTKMIVYNNPHNPT
GMNFDPKLSEELVKISRERNIILLSDEIYDYFVYEGRFKSVLEEEWRNNVIYVNGFSKTF
SMTGWRLGYIVARKEVIGKIGILASNIYTCPTSFAQKGALASFDAFDEVKEMIDLFRRRR
DVMFSELSKVKDIKVYKSSGAFYMFPDFSSILRNTGLDSKGLAIKLIEDSGVITIPGEVF
PERVGTNFLRLSFALGEEKIKEGVERMKIALEKLAG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggaaaactattcacgttcactctctaggttgaccggcgagtcgacgctcctttatcag
gagatagctagaaacgttgaaaggactaagggtataaaaactataaacttcggtataggg
caacctgatcttcctactcctaaaaggataagggaggaagctaagtcagctttagataag
ggattcactgcttacactccagccttgggcttagacgagctaaggtctagagtagccgag
tttctctctcaaaggtatggagataacatagttaaggacgaagttgcaataacgccaggc
gcgaagactgcactatttctcgcatttctgacgtatgtgaatcctggggatgaggtcatc
ctcttcgacccgtctttttactcttatgccgaggttgttaatctccttggtgggaaacca
gtttacgttccgataagatttgattcggacaggggattttacgtagatgtgaacgatgtg
gtgtcaagaataagctctaaaactaaaatgatagtctataataatccgcacaacccaaca
ggaatgaactttgaccctaagctatctgaagaattagtaaagatatctagagagagaaat
attattttattgtcagatgagatttatgattacttcgtttatgaagggagattcaagagc
gtgcttgaggaggagtggaggaataacgtaatttacgttaacggtttcagcaaaaccttc
agtatgactggatggaggttgggatacattgtagcaaggaaggaagtaataggtaaaatt
ggtatattagcgtcgaacatttatacatgtcccaccagctttgcgcaaaagggagcttta
gcgtcttttgacgcgtttgatgaggtaaaggagatgatagacctttttaggagaaggaga
gacgttatgttttcagagcttagcaaggttaaagatataaaggtctataagtcatctggg
gcgttctatatgttcccagactttagtagtattttaagaaacacagggttagattctaaa
ggtctcgcgataaaacttatagaagattcaggcgtgattacgatacctggtgaggtattt
ccagagagagtcggaacgaatttcctaaggcttagctttgccctaggagaggagaaaatt
aaagagggtgtagagaggatgaaaatagcgcttgagaaactagcaggttga

DBGET integrated database retrieval system