Microbulbifer sp. CNSA002: ACG1BZ_02725
Help
Entry
ACG1BZ_02725 CDS
T11270
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
mcns Microbulbifer sp. CNSA002
Pathway
mcns03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
mcns00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
ACG1BZ_02725 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
mcns03011
]
ACG1BZ_02725 (rplR)
Ribosome [BR:
mcns03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
ACG1BZ_02725 (rplR)
Bacteria
ACG1BZ_02725 (rplR)
Archaea
ACG1BZ_02725 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TGS
DUF2259
Motif
Other DBs
NCBI-ProteinID:
XNW48177
LinkDB
All DBs
Position
614410..614760
Genome browser
AA seq
116 aa
AA seq
DB search
MNVKKASRLRRARRARAKIRELGAVRLTVNRTPRHIYAQILSAEGSAVLASASTLDKDLR
SGKTGNADAAAAVGKLIAERAKAAGVEQVAFDRSGFRYHGRVKALADAAREAGLKF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atgaacgttaagaaagcatctcgcttgcgtcgtgcacgtcgtgcccgcgccaagatccgt
gagctgggcgccgttcgcctcaccgtgaaccgcaccccgcgccacatttacgcacagatc
ctgtctgccgaaggcagcgcggtattggcttctgcctctaccctggacaaggacctgcgc
tctggtaaaactggcaacgctgacgctgctgccgcagttggcaaactgatcgctgagcgc
gcgaaagccgctggcgttgaacaagttgccttcgatcgtagcggcttcagataccatggc
cgtgttaaggctctggctgacgctgcccgcgaagccggtctgaaattctaa
DBGET
integrated database retrieval system