KEGG   Mastomys coucha (southern multimammate mouse): 116081777
Entry
116081777         CDS       T07224                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
mcoc  Mastomys coucha (southern multimammate mouse)
Pathway
mcoc04014  Ras signaling pathway
mcoc04015  Rap1 signaling pathway
mcoc04020  Calcium signaling pathway
mcoc04022  cGMP-PKG signaling pathway
mcoc04024  cAMP signaling pathway
mcoc04070  Phosphatidylinositol signaling system
mcoc04114  Oocyte meiosis
mcoc04218  Cellular senescence
mcoc04261  Adrenergic signaling in cardiomyocytes
mcoc04270  Vascular smooth muscle contraction
mcoc04371  Apelin signaling pathway
mcoc04625  C-type lectin receptor signaling pathway
mcoc04713  Circadian entrainment
mcoc04720  Long-term potentiation
mcoc04722  Neurotrophin signaling pathway
mcoc04728  Dopaminergic synapse
mcoc04740  Olfactory transduction
mcoc04744  Phototransduction
mcoc04750  Inflammatory mediator regulation of TRP channels
mcoc04910  Insulin signaling pathway
mcoc04912  GnRH signaling pathway
mcoc04915  Estrogen signaling pathway
mcoc04916  Melanogenesis
mcoc04921  Oxytocin signaling pathway
mcoc04922  Glucagon signaling pathway
mcoc04924  Renin secretion
mcoc04925  Aldosterone synthesis and secretion
mcoc04970  Salivary secretion
mcoc04971  Gastric acid secretion
mcoc05010  Alzheimer disease
mcoc05012  Parkinson disease
mcoc05022  Pathways of neurodegeneration - multiple diseases
mcoc05031  Amphetamine addiction
mcoc05034  Alcoholism
mcoc05133  Pertussis
mcoc05152  Tuberculosis
mcoc05163  Human cytomegalovirus infection
mcoc05167  Kaposi sarcoma-associated herpesvirus infection
mcoc05170  Human immunodeficiency virus 1 infection
mcoc05200  Pathways in cancer
mcoc05214  Glioma
mcoc05417  Lipid and atherosclerosis
mcoc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcoc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    116081777
   04015 Rap1 signaling pathway
    116081777
   04371 Apelin signaling pathway
    116081777
   04020 Calcium signaling pathway
    116081777
   04070 Phosphatidylinositol signaling system
    116081777
   04024 cAMP signaling pathway
    116081777
   04022 cGMP-PKG signaling pathway
    116081777
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    116081777
   04218 Cellular senescence
    116081777
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    116081777
  09152 Endocrine system
   04910 Insulin signaling pathway
    116081777
   04922 Glucagon signaling pathway
    116081777
   04912 GnRH signaling pathway
    116081777
   04915 Estrogen signaling pathway
    116081777
   04921 Oxytocin signaling pathway
    116081777
   04916 Melanogenesis
    116081777
   04924 Renin secretion
    116081777
   04925 Aldosterone synthesis and secretion
    116081777
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    116081777
   04270 Vascular smooth muscle contraction
    116081777
  09154 Digestive system
   04970 Salivary secretion
    116081777
   04971 Gastric acid secretion
    116081777
  09156 Nervous system
   04728 Dopaminergic synapse
    116081777
   04720 Long-term potentiation
    116081777
   04722 Neurotrophin signaling pathway
    116081777
  09157 Sensory system
   04744 Phototransduction
    116081777
   04740 Olfactory transduction
    116081777
   04750 Inflammatory mediator regulation of TRP channels
    116081777
  09159 Environmental adaptation
   04713 Circadian entrainment
    116081777
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116081777
  09162 Cancer: specific types
   05214 Glioma
    116081777
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    116081777
   05163 Human cytomegalovirus infection
    116081777
   05167 Kaposi sarcoma-associated herpesvirus infection
    116081777
  09171 Infectious disease: bacterial
   05133 Pertussis
    116081777
   05152 Tuberculosis
    116081777
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116081777
   05012 Parkinson disease
    116081777
   05022 Pathways of neurodegeneration - multiple diseases
    116081777
  09165 Substance dependence
   05031 Amphetamine addiction
    116081777
   05034 Alcoholism
    116081777
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116081777
   05418 Fluid shear stress and atherosclerosis
    116081777
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcoc01009]
    116081777
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcoc04131]
    116081777
   03036 Chromosome and associated proteins [BR:mcoc03036]
    116081777
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcoc04147]
    116081777
Protein phosphatases and associated proteins [BR:mcoc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     116081777
Membrane trafficking [BR:mcoc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    116081777
Chromosome and associated proteins [BR:mcoc03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     116081777
Exosome [BR:mcoc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   116081777
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 EFhand_Ca_insen DUF5580_M Dockerin_1 RNA_pol_Rpb4 FCaBP_EF-hand Caleosin EF-hand_11 DUF1103 dCache_2 SPEF2_C SurA_N_2 SurA_N_3 RFC1 Mu-like_Pro
Other DBs
NCBI-GeneID: 116081777
NCBI-ProteinID: XP_031214315
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG
NGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGYVSAAELRHVMTKLGEKLSDE
EVEEMIQAADTDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgactgaggagcaaatcgccgagttcaaagaggctttctctctgttt
gacaaggatggggatggcagtatcaccacccaagaactgggcactgtcatgcggtccctg
ggtcagaaccccacagaggctgagctccaaggcatggtgaatgaaattgacaaggatgga
aacggcaccgtggacttccctgagttcctgacaatgatgtccaggaagatgaaagacact
gacagcgaggaggagatccgggaggccttccgagtgttcgacaaggatggcaacggctat
gtcagcgcagccgagctgaggcacgtgatgaccaagctgggggagaagctgagcgatgag
gaggtggaggaaatgatacaggcggcagatacagatggtgatgggcaagtgaactatgag
gagtttgtccacatgctagtgtccaagtga

DBGET integrated database retrieval system