KEGG   Mastomys coucha (southern multimammate mouse): 116086113
Entry
116086113         CDS       T07224                                 
Symbol
Mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mcoc  Mastomys coucha (southern multimammate mouse)
Pathway
mcoc04927  Cortisol synthesis and secretion
mcoc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcoc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    116086113 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    116086113 (Mrap)
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 116086113
NCBI-ProteinID: XP_031220224
LinkDB
Position
Unknown
AA seq 142 aa
MQPMPGDPQTSPATVMANRTDTSVPFTSYEYYLDYIDLIPVDEKKLKANKHSVVIALWLS
LATFVVLLFLILLYMSWSGSPQVRHSLQPQELCPWTHGFNFPLCLRRASLQTTGDPGSRA
GTDQWLQQQSPSASAPGPLGLP
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcagcccatgcctggagacccacagacaagcccggccacagtcatggccaacaggacc
gacacctctgtcccgttcaccagctatgagtattacctggactacatagacctcattcct
gtggatgagaagaagctgaaagccaacaagcattccgtcgtcatcgccttgtggttgagc
ctagctactttcgtggtgcttctcttcctcattctgctgtacatgtcctggtcaggatcc
ccacaggtgaggcacagtctccagccccaggaattatgtccatggactcacggcttcaac
ttccccctgtgcctccggagagcctccctgcagacaacaggggatccaggaagtagagct
ggcactgaccagtggttacagcagcagagtccttctgcctcagcccctgggcccctgggt
ctcccctag

DBGET integrated database retrieval system