KEGG   Mastomys coucha (southern multimammate mouse): 116093530
Entry
116093530         CDS       T07224                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
mcoc  Mastomys coucha (southern multimammate mouse)
Pathway
mcoc01521  EGFR tyrosine kinase inhibitor resistance
mcoc01522  Endocrine resistance
mcoc04010  MAPK signaling pathway
mcoc04012  ErbB signaling pathway
mcoc04014  Ras signaling pathway
mcoc04015  Rap1 signaling pathway
mcoc04062  Chemokine signaling pathway
mcoc04068  FoxO signaling pathway
mcoc04071  Sphingolipid signaling pathway
mcoc04072  Phospholipase D signaling pathway
mcoc04137  Mitophagy - animal
mcoc04140  Autophagy - animal
mcoc04150  mTOR signaling pathway
mcoc04151  PI3K-Akt signaling pathway
mcoc04210  Apoptosis
mcoc04211  Longevity regulating pathway
mcoc04213  Longevity regulating pathway - multiple species
mcoc04218  Cellular senescence
mcoc04360  Axon guidance
mcoc04370  VEGF signaling pathway
mcoc04371  Apelin signaling pathway
mcoc04540  Gap junction
mcoc04550  Signaling pathways regulating pluripotency of stem cells
mcoc04625  C-type lectin receptor signaling pathway
mcoc04650  Natural killer cell mediated cytotoxicity
mcoc04660  T cell receptor signaling pathway
mcoc04662  B cell receptor signaling pathway
mcoc04664  Fc epsilon RI signaling pathway
mcoc04714  Thermogenesis
mcoc04720  Long-term potentiation
mcoc04722  Neurotrophin signaling pathway
mcoc04725  Cholinergic synapse
mcoc04726  Serotonergic synapse
mcoc04730  Long-term depression
mcoc04810  Regulation of actin cytoskeleton
mcoc04910  Insulin signaling pathway
mcoc04912  GnRH signaling pathway
mcoc04915  Estrogen signaling pathway
mcoc04916  Melanogenesis
mcoc04917  Prolactin signaling pathway
mcoc04919  Thyroid hormone signaling pathway
mcoc04921  Oxytocin signaling pathway
mcoc04926  Relaxin signaling pathway
mcoc04929  GnRH secretion
mcoc04933  AGE-RAGE signaling pathway in diabetic complications
mcoc04935  Growth hormone synthesis, secretion and action
mcoc05010  Alzheimer disease
mcoc05022  Pathways of neurodegeneration - multiple diseases
mcoc05034  Alcoholism
mcoc05160  Hepatitis C
mcoc05161  Hepatitis B
mcoc05163  Human cytomegalovirus infection
mcoc05165  Human papillomavirus infection
mcoc05166  Human T-cell leukemia virus 1 infection
mcoc05167  Kaposi sarcoma-associated herpesvirus infection
mcoc05170  Human immunodeficiency virus 1 infection
mcoc05200  Pathways in cancer
mcoc05203  Viral carcinogenesis
mcoc05205  Proteoglycans in cancer
mcoc05206  MicroRNAs in cancer
mcoc05207  Chemical carcinogenesis - receptor activation
mcoc05208  Chemical carcinogenesis - reactive oxygen species
mcoc05210  Colorectal cancer
mcoc05211  Renal cell carcinoma
mcoc05213  Endometrial cancer
mcoc05214  Glioma
mcoc05215  Prostate cancer
mcoc05216  Thyroid cancer
mcoc05218  Melanoma
mcoc05219  Bladder cancer
mcoc05220  Chronic myeloid leukemia
mcoc05221  Acute myeloid leukemia
mcoc05223  Non-small cell lung cancer
mcoc05224  Breast cancer
mcoc05225  Hepatocellular carcinoma
mcoc05226  Gastric cancer
mcoc05230  Central carbon metabolism in cancer
mcoc05231  Choline metabolism in cancer
mcoc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcoc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcoc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    116093530 (Nras)
   04015 Rap1 signaling pathway
    116093530 (Nras)
   04068 FoxO signaling pathway
    116093530 (Nras)
   04072 Phospholipase D signaling pathway
    116093530 (Nras)
   04071 Sphingolipid signaling pathway
    116093530 (Nras)
   04151 PI3K-Akt signaling pathway
    116093530 (Nras)
   04150 mTOR signaling pathway
    116093530 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116093530 (Nras)
   04137 Mitophagy - animal
    116093530 (Nras)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    116093530 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    116093530 (Nras)
   04660 T cell receptor signaling pathway
    116093530 (Nras)
   04662 B cell receptor signaling pathway
    116093530 (Nras)
   04664 Fc epsilon RI signaling pathway
    116093530 (Nras)
   04062 Chemokine signaling pathway
    116093530 (Nras)
  09152 Endocrine system
   04929 GnRH secretion
    116093530 (Nras)
   04915 Estrogen signaling pathway
    116093530 (Nras)
   04917 Prolactin signaling pathway
    116093530 (Nras)
   04921 Oxytocin signaling pathway
    116093530 (Nras)
   04926 Relaxin signaling pathway
    116093530 (Nras)
   04935 Growth hormone synthesis, secretion and action
    116093530 (Nras)
   04919 Thyroid hormone signaling pathway
    116093530 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    116093530 (Nras)
   04726 Serotonergic synapse
    116093530 (Nras)
   04720 Long-term potentiation
    116093530 (Nras)
   04730 Long-term depression
    116093530 (Nras)
   04722 Neurotrophin signaling pathway
    116093530 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    116093530 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    116093530 (Nras)
   04213 Longevity regulating pathway - multiple species
    116093530 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    116093530 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    116093530 (Nras)
   05206 MicroRNAs in cancer
    116093530 (Nras)
   05205 Proteoglycans in cancer
    116093530 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    116093530 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    116093530 (Nras)
   05203 Viral carcinogenesis
    116093530 (Nras)
   05230 Central carbon metabolism in cancer
    116093530 (Nras)
   05231 Choline metabolism in cancer
    116093530 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    116093530 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    116093530 (Nras)
   05225 Hepatocellular carcinoma
    116093530 (Nras)
   05226 Gastric cancer
    116093530 (Nras)
   05214 Glioma
    116093530 (Nras)
   05216 Thyroid cancer
    116093530 (Nras)
   05221 Acute myeloid leukemia
    116093530 (Nras)
   05220 Chronic myeloid leukemia
    116093530 (Nras)
   05218 Melanoma
    116093530 (Nras)
   05211 Renal cell carcinoma
    116093530 (Nras)
   05219 Bladder cancer
    116093530 (Nras)
   05215 Prostate cancer
    116093530 (Nras)
   05213 Endometrial cancer
    116093530 (Nras)
   05224 Breast cancer
    116093530 (Nras)
   05223 Non-small cell lung cancer
    116093530 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    116093530 (Nras)
   05170 Human immunodeficiency virus 1 infection
    116093530 (Nras)
   05161 Hepatitis B
    116093530 (Nras)
   05160 Hepatitis C
    116093530 (Nras)
   05163 Human cytomegalovirus infection
    116093530 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    116093530 (Nras)
   05165 Human papillomavirus infection
    116093530 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    116093530 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    116093530 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    116093530 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    116093530 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    116093530 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    116093530 (Nras)
   01522 Endocrine resistance
    116093530 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcoc04131]
    116093530 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcoc04147]
    116093530 (Nras)
   04031 GTP-binding proteins [BR:mcoc04031]
    116093530 (Nras)
Membrane trafficking [BR:mcoc04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    116093530 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    116093530 (Nras)
Exosome [BR:mcoc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116093530 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   116093530 (Nras)
  Exosomal proteins of breast cancer cells
   116093530 (Nras)
  Exosomal proteins of colorectal cancer cells
   116093530 (Nras)
GTP-binding proteins [BR:mcoc04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    116093530 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 116093530
NCBI-ProteinID: XP_031230879
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMRRLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgaca
atccagctaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtgattgacggtgagacctgtctgctggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaagggttcctctgt
gtatttgccatcaataatagcaagtcgtttgcagatattaacctctacagggagcagata
aagcgtgtgaaagactctgatgatgtacccatggtgctggtagggaacaagtgtgacttg
ccaacaaggacagttgacacaaagcaggcccatgagctggccaagagttacggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaggatgccttttacacactggta
agggagatacgccagtaccgaatgagaagacttaacagcagtgatgatggcactcaaggt
tgtatggggctgccctgtgtagtgatgtag

DBGET integrated database retrieval system