Mycoplasmopsis californica ST-6: MCFN_03065 Help Entry MCFN_03065        CDS       T03247                                  Symbol hup Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism mcr  Mycoplasmopsis californica ST-6 Brite KEGG Orthology (KO) [BR:mcr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mcr03032]     MCFN_03065 (hup)    03036 Chromosome and associated proteins [BR:mcr03036]     MCFN_03065 (hup)    03400 DNA repair and recombination proteins [BR:mcr03400]     MCFN_03065 (hup) DNA replication proteins [BR:mcr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     MCFN_03065 (hup) Chromosome and associated proteins [BR:mcr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     MCFN_03065 (hup) DNA repair and recombination proteins [BR:mcr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       MCFN_03065 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 Motif Other DBs NCBI-ProteinID:  AIA29728 UniProt:  A0A059XSE5 LinkDB All DBs Position complement(716923..717201) Genome browser AA seq 92 aa AA seqDB search MTKKEFMAEVAEKMGVPVRTANEFFDKFIIVLKDYLSEGEKVQLSVLGTFDVVERARRET TNPFTKELLVIEPKKVIKFRPSKFLKEAVDKN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgactaaaaaagaatttatggccgaagtagctgaaaagatgggtgttccagtaagaact gcaaatgaattttttgataaattcataattgttctgaaagactatctttcagagggggaa aaggttcaattgagcgtactaggaacttttgatgttgttgaacgtgctagacgtgaaaca acaaacccatttacaaaagaattgttggttatcgaacctaaaaaagttattaagttcagg ccatctaaattcctaaaagaagccgttgataaaaactag

DBGET integrated database retrieval system