Micromonospora craniellae: ID554_27890 Help Entry ID554_27890       CDS       T06957                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mcra  Micromonospora craniellae Pathway mcra00998   Biosynthesis of various antibiotics mcra01100   Metabolic pathways mcra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ID554_27890    00074 Mycolic acid biosynthesis     ID554_27890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ID554_27890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QOC91703 LinkDB All DBs Position complement(6157306..6157536) Genome browser AA seq 76 aa AA seqDB search MDDLQRMRKVWEFIFQQSVTDDADFFTDLDGDSMAAAALVHHVAEEFGVSLPLFEVFDRP TPAELLVAVREQLTVG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgcagagaatgcgcaaggtctgggagttcatcttccagcagtcggtcacc gacgacgccgacttcttcaccgacctcgacggcgactcgatggccgccgccgccctcgtg caccacgtcgccgaggaattcggtgtctcgctgcccctgttcgaggtgttcgaccgcccg acgcccgcggaactgctcgtggccgtacgggaacagctcacggtcggctga

DBGET integrated database retrieval system