KEGG   Moraxella catarrhalis 25240: DR90_156
Entry
DR90_156          CDS       T03217                                 
Name
(GenBank) putative permease YjgP/YjgQ family protein
  KO
K11720  lipopolysaccharide export system permease protein
Organism
mcs  Moraxella catarrhalis 25240
Pathway
mcs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mcs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DR90_156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcs02000]
    DR90_156
Transporters [BR:mcs02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    DR90_156
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AIK00901
LinkDB
Position
176453..177562
AA seq 369 aa
MKSWILPKYVIRSALLAMAGAVVGLWLVQMVFAYLAELDNISETYTLTDALLFILYRSPY
FLVQFIPTGTLLGAVIGLGLLANHSELIVMRAAGMSIYRIVSWAMLPAVIFVVISLGVNQ
FVLPTANQHAAAIRADTIYDKLITIDGYWSVNHDGDSQDVVYISYADNEGGLGEVKRYQL
KDGQLIAALKAKSGVYLPQSDDVMNAQKARYTWQLSGIDEIGIGTSQVQQAHSEGKILTL
PIAPTDVYLLTKEPEDLSLSSLYAHRQLMAHQGTRSLRHELAFWQKLLSPFAVLSLVLVA
SSFVFGSLRSQGLGLRVVLALLTGLLFSYLTDLTGFVALATGLSPLLMALVPIVLSAMAG
MYLLNRKSS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaatcatggattttaccaaaatatgtcatccgctcagcactgcttgccatggcaggt
gctgtggtgggtttatggcttgtacagatggtatttgcttatttggccgagcttgataat
atcagtgaaacatatacgctgaccgatgcactgctatttattttgtatcgctcgccttat
tttttggtgcaatttatcccaactggcacacttttgggggcagtcattggtttgggcttg
cttgccaatcacagtgagcttatcgtgatgcgagctgctggcatgagcatatatcgtatc
gtcagctgggcgatgttgcctgcggtcatttttgttgtcatatcgctgggtgtcaatcaa
tttgtcctgcctaccgccaatcagcatgccgctgccatcagagcagataccatttatgat
aagcttatcacgattgatggctattggtcagtcaatcatgatggcgatagtcaagatgtg
gtttatatcagctatgccgacaacgaaggtgggcttggagaggtcaaacgatatcagctc
aaagatggtcagctaatcgctgcactcaaagcaaaatcaggcgtatatttgccacagtct
gatgatgtgatgaatgcacaaaaagcccgctatacttggcagttatcaggcattgatgag
attggcatcggtacatcacaagtgcaacaagcacacagcgaaggcaaaatactgacctta
ccgattgcaccgaccgatgtgtatttattgaccaaagagcctgaagatttatcacttagc
agtttgtacgcccacaggcagctcatggcacatcaaggcacacgctcactgcgtcatgaa
ttggcattttggcaaaagctactttcgccctttgcggtgctttcgttagtattggtggca
tcatcatttgtctttggttcactgcgttcccaaggcttgggactgcgagtggtcttggca
cttttaacgggtcttttatttagttatttgactgatttgacgggctttgtggctttggca
acgggtctttcgccactgttaatggcactggtgccgatcgtgctatcagcgatggcgggt
atgtatttactaaatcgcaaatcaagctaa

DBGET integrated database retrieval system