KEGG   Moraxella catarrhalis 25240: DR90_896
Entry
DR90_896          CDS       T03217                                 
Name
(GenBank) ABC transporter family protein
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
mcs  Moraxella catarrhalis 25240
Pathway
mcs00920  Sulfur metabolism
mcs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mcs00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DR90_896
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DR90_896
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcs02000]
    DR90_896
Enzymes [BR:mcs01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     DR90_896
Transporters [BR:mcs02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    DR90_896
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 ABC_ATPase AAA ATPase_2 AAA_16 AAA_23 AAA_25 SbcC_Walker_B AAA_15 RsgA_GTPase AAA_18 ORC-CDC6-like AAA_28 AAA_29 NACHT Rad17 AAA_14 AAA_30 AAA_5
Other DBs
NCBI-ProteinID: AIK01242
UniProt: A0A3A9KS60
LinkDB
Position
complement(958693..959412)
AA seq 239 aa
MSIKIQNIHKTFGDFVALGEISIDISTGELTTLLGPSGCGKTTLLRIIAGLENADNGRIY
FDSIDVTDIPVQHRGIGFVFQQYALFRHQTVAQNIAFGLTLLPRNTRPSANTIDRRVDEL
LDLVQLSHTKTRYPHELSGGQRQRVALARALATEPKLLLLDEPFGALDAKVRKSLRDSLK
DIQREIGITSILVTHDQEEAQAISDKIVIMNHGQIEQIGTPSKLFAQPSSDFVVDFLGL
NT seq 720 nt   +upstreamnt  +downstreamnt
atgagtattaaaatccaaaacatccataaaactttcggggattttgttgccttaggtgaa
atcagcattgatatttcaacaggtgagctgacaactttattaggtccatcaggctgtggc
aagacaactttgctacgcattattgcaggtcttgaaaatgcagacaacgggcggatatat
tttgacagtatcgatgtaactgatataccagtgcaacaccgtggtatcggttttgtgttt
cagcaatatgcgttatttcgacatcaaacggttgcacaaaacattgcttttggcttgacg
ctgttgcctcgcaatacacgcccttctgccaatacaattgatcggcgtgtggatgagctg
cttgatttggtgcaacttagccacaccaaaacccgctatccgcatgagctatcaggtggc
cagcgtcagcgtgttgctttggcacgtgcactggcgaccgagcctaagctgctgctactt
gatgagccttttggcgcgcttgatgccaaagtgcgtaaatcgctgcgtgattcgctcaaa
gacattcagcgtgaaattggtatcaccagcatcttggttacgcatgaccaagaagaagct
caagccatatctgataaaattgtcattatgaatcatgggcaaattgagcaaattggcaca
ccaagcaagttatttgcccagccaagcagtgattttgtggtggattttttgggcttataa

DBGET integrated database retrieval system