Moraxella catarrhalis BBH18: MCR_1266 Help Entry MCR_1266          CDS       T01224                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mct  Moraxella catarrhalis BBH18 Brite KEGG Orthology (KO) [BR:mct00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mct03110]     MCR_1266 (grxC) Chaperones and folding catalysts [BR:mct03110]  Protein folding catalysts   Protein disulfide isomerase    MCR_1266 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like SH3BGR GST_N_3 Thioredoxin_3 Thioredoxin_2 GST_N_2 TXD17-like_Trx Motif Other DBs NCBI-ProteinID:  ADG61527 LinkDB All DBs Position 1263317..1263592 Genome browser AA seq 91 aa AA seqDB search MQKVTIYTTPTCPYCLAAKQLLNNKSVAYDEISMYDINAEDREALSAKTNGYRTVPQIFI GDNFIGGFDQLNKLNADGKLDELLVQSFSHF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaagtaaccatctataccacaccgacctgcccttattgcttggctgccaagcag cttttgaataataaatctgttgcttatgatgagattagcatgtatgatatcaatgctgag gatcgtgaagcactctcagccaaaaccaatggctatcgtactgtcccacaaatctttatt ggtgataatttcattggcggttttgatcagcttaataaattaaatgccgatggcaaactt gatgagcttttggtgcaatcatttagccatttttaa

DBGET integrated database retrieval system