Moraxella catarrhalis BBH18: MCR_1552 Help Entry MCR_1552          CDS       T01224                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mct  Moraxella catarrhalis BBH18 Pathway mct01100   Metabolic pathways mct01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mct00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MCR_1552    00074 Mycolic acid biosynthesis     MCR_1552   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MCR_1552 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ADG61809 LinkDB All DBs Position complement(1542211..1542447) Genome browser AA seq 78 aa AA seqDB search MSDIEAKVKDAVAEQLGLSVDEIKNEASFMDDLGADSLDLVELVMAFESSFGITIPDEDS AELTTVQKAIDYVSDKVA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatatcgaagctaaagtaaaagacgcagtcgcagaacagcttggtttaagtgtt gacgaaatcaaaaacgaggcatcttttatggatgacttgggtgctgattctttggatttg gttgagttagttatggcatttgaaagcagctttggcatcaccattcctgatgaagattca gcggaactgacgacggttcaaaaagccatcgactatgtttctgacaaagtcgcttaa

DBGET integrated database retrieval system