Methanobacterium congolense: MCBB_1629 Help Entry MCBB_1629         CDS       T04503                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mcub  Methanobacterium congolense Pathway mcub03010   Ribosome Brite KEGG Orthology (KO) [BR:mcub00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MCBB_1629 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MCBB_1629 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mcub03011]     MCBB_1629 (rps27ae)    04121 Ubiquitin system [BR:mcub04121]     MCBB_1629 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mcub04147]     MCBB_1629 (rps27ae) Ribosome [BR:mcub03011]  Ribosomal proteins   Eukaryotes    Small subunit     MCBB_1629 (rps27ae)   Archaea     MCBB_1629 (rps27ae) Ubiquitin system [BR:mcub04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MCBB_1629 (rps27ae) Exosome [BR:mcub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MCBB_1629 (rps27ae)   Exosomal proteins of colorectal cancer cells    MCBB_1629 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 NCD3G Motif Other DBs NCBI-ProteinID:  SCG86184 UniProt:  A0A1D3L3F2 LinkDB All DBs Position I:1679473..1679631 Genome browser AA seq 52 aa AA seqDB search MKKYQLYEVKDNKIIRKNPECVRCSHGVFMADHGDRYACGRCGYTQWKKDKK NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaataccagctttacgaagttaaggataacaagatcataaggaaaaacccagag tgtgtaagatgttcccacggagtctttatggctgaccacggagacaggtacgcatgtgga agatgcggttacacccagtggaaaaaggataagaaatag

DBGET integrated database retrieval system