Microbacterium aurantiacum: A8L33_04785 Help Entry A8L33_04785       CDS       T04340                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism mcw  Microbacterium aurantiacum Pathway mcw03060   Protein export mcw03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mcw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A8L33_04785  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A8L33_04785  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mcw02044]     A8L33_04785 Secretion system [BR:mcw02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A8L33_04785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ANG84792 UniProt:  A0A0N0RRS6 LinkDB All DBs Position 992771..993022 Genome browser AA seq 83 aa AA seqDB search MLNNLTGWHAVLILVVILLLFGAGKLPALAKSAGQSARILKSELREGATAPTLAPDAPST ATAESSAEPQPRVSSTPPPPSTA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctgaacaacctcaccgggtggcacgccgtcctcatcctcgtcgtgatcctgctgctc ttcggcgccgggaagctcccggccctcgccaagagcgccgggcagtccgcgcggatcctg aagtccgagctccgcgaaggagcgacggcgcccaccctcgcacccgacgcaccctcgacg gcgacggccgagagctccgccgagccgcagccccgggtctcctccacaccgcccccgccc tcgacggcctga

DBGET integrated database retrieval system