Musca domestica (house fly): 101890483 Help Entry 101890483         CDS       T03448                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism mde  Musca domestica (house fly) Pathway mde04070   Phosphatidylinositol signaling system mde04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:mde00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     101890483  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     101890483  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mde01009]     101890483   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mde04131]     101890483    03036 Chromosome and associated proteins [BR:mde03036]     101890483   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mde04147]     101890483 Protein phosphatases and associated proteins [BR:mde01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101890483 Membrane trafficking [BR:mde04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101890483 Chromosome and associated proteins [BR:mde03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101890483 Exosome [BR:mde04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101890483 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin TerB FCaBP_EF-hand DUF5580_M SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  101890483 NCBI-ProteinID:  XP_019891648 UniProt:  T1PNX0 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcaactaacagaagaacaaatcgccgaattcaaagaagctttctcactattc gataaagatggtgatggcaccatcacaacaaaggaattgggcacagtcatgcgatcactt ggccaaaatcccacagaagctgaattacaggacatgatcaatgaagtcgatgctgatggc aacggcacaattgatttccctgaattcttgacaatgatggcccgtaaaatgaaggacacc gatagtgaagaagaaatccgagaagccttcagagtattcgacaaagacggtaacggcttc atttcagcggctgaattgcgtcatgtcatgacaaatttgggtgaaaagttaacagacgaa gaagtcgatgagatgattcgagaagctgatatcgatggtgatggtcaagtcaattacgaa gaattcgtgactatgatgacatcgaagtga

DBGET integrated database retrieval system