KEGG   Musca domestica (house fly): 101901255
Entry
101901255         CDS       T03448                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
mde  Musca domestica (house fly)
Pathway
mde00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    101901255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mde00199]
    101901255
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     101901255
Cytochrome P450 [BR:mde00199]
 Cytochrome P450, animal type
  CYP306 family
   101901255
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101901255
NCBI-ProteinID: XP_011292479
UniProt: A0A1I8N403
LinkDB
Position
Unknown
AA seq 516 aa
MEFSPPQLFAIVVASVVFLIRLVFLRVRHQPGGPFGIPLLGYLPFIDVKAPYKTLQRLAV
KYGPIYKLKMGNVNAIVLSDAALVREFLKREEFTARAPLYVTHGIMGGYGLICSEGPLWR
DQRRHTIDWLKALGMSKKFADMRSGLEQRISKGVQECVQCLQQDSKNLSMAVNPLPALQH
TLGNIMNDLVFGITYARDDVTWRYLQELQETGVKLIGVSGVVNFLPFLRFLPSNRRNIKF
LLDGKAKTHQIYDDIVRKCEEKMQKRKFQPTKESLKNTCILEFFLEQREELKNHVDLYHR
SKYDEYFCPEQLRHLLADLFGAGVDTTLSTLRWFILYMAKEQEIQRELREHLQKLPKDNI
TLSDLEEIDYLRACISEVQRIRSVVPLGIPHGTKWNVNVNGHGIPKDSMVLPLQWAIHMD
PKVWPEPETFNPQRFLNDEGGYQASSNFIPFQTGKRMCLGEDLARMMLLLYSGFLVRNFE
FHLSTDDAERVDDIFDGECGITLTPKEYRVTLKAIK
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggaattttcaccaccgcaactctttgccattgttgtggcctcagtcgtatttctgata
cggctagtatttctacgtgtgcgtcatcagccgggaggaccatttggtatacccctattg
ggctatttgccattcatagacgtgaaagcaccatacaagacattgcagcgtttggctgtg
aaatatggtcccatctataagctgaaaatgggcaatgtcaatgcgattgtattgtcggat
gctgctttggtaagggaattcctgaaacgtgaagaatttacagcgcgcgcaccattgtat
gttactcatggcataatgggtggttatggtctaatttgctccgaaggtcctttatggaga
gatcaaagacgtcacacaattgattggctcaaggcattgggtatgtcgaagaaatttgcc
gatatgcgtagtggcctggaacaacgcatctctaagggagtccaggaatgtgtacagtgt
cttcaacaggattctaagaacttatcaatggcagtgaatcctctgccagcacttcagcac
actctgggcaacataatgaatgacttggtgtttggcatcacatatgcacgcgatgatgtc
acttggcgttatttgcaggaattgcaggaaacgggcgttaaactaatcggtgtttcgggg
gtagtcaattttctgccattcttgagatttttaccctccaatcgtcgcaatattaaattc
ctattggacggcaaagcgaaaacccatcaaatctatgatgacattgtacgaaaatgtgaa
gaaaagatgcaaaaacgcaaattccaaccaacgaaggagtcgctgaagaacacatgtatt
ttggaattcttcttggaacaaagagaagaattgaaaaatcatgttgacctttatcatcgt
tccaaatatgatgaatatttttgccccgaacagttgcgccatctattggctgatctattt
ggggctggagttgataccactttgtccactttgagatggtttattttgtacatggccaag
gagcaggagattcaaagggaactgagagagcatttacaaaaactacccaaagacaatatt
accctaagcgatttagaagaaattgactatttacgagcttgcatatccgaagtgcaacgc
atacgatcggtggtgcctctgggcattcctcacggcacaaaatggaatgtgaatgtcaat
ggccatggcatacccaaagattccatggtgctgccgctacaatgggcaatacatatggat
ccaaaggtgtggcccgaacccgaaacgttcaatcctcaacggtttctcaacgacgagggt
ggctatcaagcatctagcaattttattcccttccaaaccggaaagcgcatgtgtcttggt
gaagatttggcacgaatgatgttgctcttatatagcggttttctggttagaaatttcgaa
ttccatttgagtacagatgatgcagaacgcgttgatgacattttcgatggtgaatgtggc
ataacattgacacccaaagaatatcgtgtgacattgaaggcaattaaataa

DBGET integrated database retrieval system