Musca domestica (house fly): 101901639 Help Entry 101901639         CDS       T03448                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism mde  Musca domestica (house fly) Pathway mde04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mde00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101901639  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mde04121]     101901639    03400 DNA repair and recombination proteins [BR:mde03400]     101901639 Ubiquitin system [BR:mde04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101901639    Cul5 complex      101901639 DNA repair and recombination proteins [BR:mde03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101901639 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  101901639 NCBI-ProteinID:  XP_005185116 UniProt:  A0A1I8MEP4 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MEEPRSDKIYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENEAN EVHFREIPSHILQKVCIYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggaaccacgcagcgataaaatctatggcggatgtgagggccccgatgccatgtat gtcaaattaatctcttcggatggccatgaatttattgtcaaaagggaacacgctttaacc tctggcaccatcaaggctatgctttctggacctggccagtttgctgaaaatgaagctaat gaagtgcattttcgagaaataccctcacacatcttgcaaaaagtatgcatttactttacc tacaaagtgcgttacacaaatagctctacagagattccagaatttccgattgcccccgaa atcgctttggaactgttaatggctgcaaactttttagattgttag

DBGET integrated database retrieval system