Musca domestica (house fly): 131805909 Help Entry 131805909         CDS       T03448                                  Name (RefSeq) probable insulin-like peptide 3   KO K04526   insulin Organism mde  Musca domestica (house fly) Pathway mde04068   FoxO signaling pathway mde04081   Hormone signaling mde04140   Autophagy - animal mde04150   mTOR signaling pathway mde04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:mde00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     131805909    04150 mTOR signaling pathway     131805909   09133 Signaling molecules and interaction    04081 Hormone signaling     131805909  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131805909  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     131805909  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mde04052]     131805909 Cytokines and neuropeptides [BR:mde04052]  Neuropeptides   Unclassified    131805909 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin CARF-assoc_HTH Motif Other DBs NCBI-GeneID:  131805909 NCBI-ProteinID:  XP_058985678 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MKLLGALVFLALCYEIQSAATRFCGQNLVQILDAVCVDGFYGMQMSKKSMGRLLHHGLLD VIGSNEIDNEAHPKSSSLLSDMLSGEGLNGLAKTRRQRHLNGVYDECCRKGCTLNEIAGY CL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaaacttcttggtgctctggtatttttggccctttgctatgaaattcaatcggcagca actcgtttctgtggccaaaatttggttcagattctggacgctgtgtgtgtagatggtttc tatggcatgcagatgagtaaaaagtccatgggacgactacttcatcatggattattggat gtaattggatcaaatgaaatcgacaatgaggcacaccctaaatccagttccctgctcagt gatatgttgtctggcgagggattgaatggtctagccaagactcgcagacaacgtcatttg aatggagtctatgatgaatgctgtcgaaaaggttgtacattgaatgaaatcgccggatac tgcctttaa

DBGET integrated database retrieval system