Musca domestica (house fly): 131806020 Help Entry 131806020         CDS       T03448                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism mde  Musca domestica (house fly) Pathway mde03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:mde00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     131806020  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mde03036]     131806020   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mde04147]     131806020 Chromosome and associated proteins [BR:mde03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131806020 Exosome [BR:mde04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131806020 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  131806020 NCBI-ProteinID:  XP_058985869 UniProt:  A0ABM3VJJ0 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT EKKA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggtaaaggtggcaaagttaagggaaaggcaaagtcccgttccaatcgt gctggtcttcaattccccgtcggtcgtatccatcgtctgttgcgcaaaggcaactatgct gagcgtgttggtgccggtgctcccgtctatttagccgctgtcatggaatatttggctgct gaagtcttggaattggctggcaatgctgcccgtgacaacaagaagactcgtatcattccc cgtcacttgcaattggccatccgtaacgacgaagaattgaacaaattgctgtctggcgtt accattgcccaaggtggtgtattgccaaacatccaagctgttctcttgcccaagaagacc gaaaagaaagcctaa

DBGET integrated database retrieval system