Methylomonas sp. DH-1: AYM39_02095
Help
Entry
AYM39_02095 CDS
T04396
Name
(GenBank) oxidoreductase
KO
K00342
NADH-quinone oxidoreductase subunit M [EC:
7.1.1.2
]
Organism
mdh
Methylomonas sp. DH-1
Pathway
mdh00190
Oxidative phosphorylation
mdh01100
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:
mdh00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
AYM39_02095
Enzymes [BR:
mdh01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
AYM39_02095
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Proton_antipo_M
Oxidored_q5_N
Motif
Other DBs
NCBI-ProteinID:
ANE54097
LinkDB
All DBs
Position
476550..478022
Genome browser
AA seq
490 aa
AA seq
DB search
MAILSTLLWTPAAGALVLVLIPAQRAQAVRLAANLFAAAALVLACILLARYDAADPALQF
NEFYPLNPKLGSAYALGIDGLSLPMLVLAALLTSISLIASFNLADGVKGYHICILLLEFG
MLGVFMAQDWALFYIFWEVTLIPLFFLIDRWGGKRRHAASLNFVLYTMGGSVFMLLSLLA
ISQYDLQNQGSLMASMGQAAQNMPAVEQVLVLLGFLIGFGVKMPIFPLHGWLPLAHVEAP
SAVSILLSGILLKMGAYGLLRSVVMLPVAAQMIQPLLMFLALFGMVYGGLLAWRQPDMKA
MVAYSSLSHMGVVLLGIATLNRTGFIGAILQMSAHGLIAGALFLLVGLLYERTHTRNIQD
YSSLVQVMPRFAGLATLALLAAMGLPGSIGFVAELHTVIGGFQQWGGWMAFFSLSILISA
AYAMRTIGLLFTGPVKPQMRDVADLTPPELAASAVLVGGIVVFGLLPAPLIELSAASVGR
MLAVIGERLL
NT seq
1473 nt
NT seq
+upstream
nt +downstream
nt
atggccatactcagcacgctgctttggacccccgctgccggggcgctggtgctagtactg
attcccgcccagcgggcgcaagcggtgcgcctggcggccaatctgttcgccgctgcggcg
ctggttctggcttgcatactgttggcgcgctacgatgccgccgatccggcattgcaattc
aacgaattctacccgctcaaccccaaactcggtagcgcctatgccttgggcatcgacggc
ctgtcgttgccgatgctggtcctggcggcgctactgacctcgatttcgctgatcgcgtcc
tttaatctggccgacggcgtcaagggttaccacatctgcatcctgctgctcgaattcggc
atgctcggcgtgttcatggcccaggactgggccttgttctatatcttttgggaagtgacc
ctgatcccgttgttttttctgatagaccgctggggcggcaaacgccgccatgccgccagc
ctgaacttcgtgttgtacacgatgggcggctcggtgttcatgctgctgagtttgttggcg
atcagccagtacgacttgcagaaccagggctcgttgatggcgtcgatggggcaggcggcg
cagaacatgccggccgtcgaacaagtgctggtgctgctgggttttttgatcggtttcggc
gtgaagatgccgatttttccgctgcacggttggctgccgctggcgcacgtcgaagcgccg
agcgcggtcagtatcctgttgtccggcattttattgaagatgggggcttacggtctgctg
cggtcggtggtgatgctgccggttgccgcgcaaatgatccagccgctgctgatgtttctg
gctctgttcggtatggtttacggcggcctgctggcttggcgccagccggatatgaaagcg
atggtggcctattcgtcgttgagccacatgggcgtggtgttgctcggcatcgccaccttg
aaccggaccggcttcatcggcgccattctgcaaatgagcgcgcacggcctgatcgccggc
gccttgttcctgctggtggggctgctgtacgaacgcacccatacccgcaatatccaggat
tacagttcgttggtgcaggtgatgccgcgttttgccgggctggcgacgctggcgctgctg
gcggcgatgggcctgccgggctcgatcggctttgtcgccgaattgcacaccgtgatcggc
ggctttcagcaatggggcggctggatggcgtttttcagcctgagcatactgatcagcgcg
gcctatgccatgcgcaccatcggcctgctgttcaccggtccggtcaagccgcagatgcgc
gacgttgccgatttgacgccgcctgagctggcagcgtcggcggttttggtcggcggtatc
gttgtattcggcttgctgccggcgccgttgatcgagttatcggccgcgtcggtggggcga
atgttggccgtgatcggcgagaggttgctgtga
DBGET
integrated database retrieval system