KEGG   Methylomonas sp. DH-1: AYM39_02575
Entry
AYM39_02575       CDS       T04396                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mdh  Methylomonas sp. DH-1
Pathway
mdh02020  Two-component system
mdh02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mdh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYM39_02575
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    AYM39_02575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mdh02022]
    AYM39_02575
   02035 Bacterial motility proteins [BR:mdh02035]
    AYM39_02575
Enzymes [BR:mdh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AYM39_02575
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     AYM39_02575
Two-component system [BR:mdh02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   AYM39_02575
Bacterial motility proteins [BR:mdh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AYM39_02575
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: ANE54183
LinkDB
Position
576143..577243
AA seq 366 aa
MAIRVLVVDDSHFICHRVTEILEEDQEFKVVGVAHDGRQAVEMAAALQPDVITMDVDMPV
MDGISAVKRIMSTRPVPILMFSAMTQVGARATFDALSAGAIDFLPKQMEDIDANRETARY
LLRYRVRMVAGQAAKVAAAGTLGDAGLRRSGGFAAHIGAAAVAKERVLPAKPSQADPGKI
DLLAVAASTGGPVAMQYVLSRVPASCSMPILLIQHMPPNFTKSFAERLNSLCSIEVREAQ
DGDILQPGVALLSPGAVQMQLKQTPGSRQIALRPKQAGEIYSPSVDITFSSLADNFAGRV
LAVVLTGMGADGKLGAMKLRQRGAQIWAQDEASSTIYGMPKAIAEAGLADHVYSLDEIAN
QFNKLH
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggccattcgggtattggtagtcgatgattcccatttcatctgccacagagttaccgaa
attctggaagaagaccaagagttcaaagtagtcggcgtggcccatgacgggcggcaggcg
gttgaaatggctgcggcgctgcagccggacgtgatcacgatggatgtggatatgccggtg
atggacggtatctccgccgtcaaacgcatcatgagtacccggccggtgccgattttgatg
ttttcggccatgacccaggtcggtgcccgcgccacgttcgatgcgttgagtgcaggtgcc
atcgattttctgccgaagcaaatggaagatatcgatgccaatcgggaaaccgcccgttac
ctgttgcgttaccgggtcagaatggtggcgggacaggcggcaaaagtggccgcggccgga
acgcttggcgatgccggcctgaggcgtagcggcggatttgcagcccatatcggcgcagcg
gcggttgccaaggagcgggtgttgccggccaagccgagtcaagccgatccgggcaaaatc
gatctgttggctgtggcggcttccaccggcggaccggtagccatgcaatacgtgttgagc
cgagttccggctagttgttcgatgccgatattgctgatacagcacatgccgccgaatttc
accaaaagctttgccgagcggctgaattcgctgtgcagtatcgaagtccgggaagcgcag
gacggcgatatcctgcaacccggtgtggcactgttaagtccgggagcggtgcaaatgcag
ctcaaacaaacgccgggttcccgccaaatcgcgttacgccccaaacaagccggcgaaatc
tatagtcccagcgtcgatatcacattcagttcgttggccgacaatttcgccggccgagta
ctcgctgtggtgctgaccggcatgggggcggacggtaaactcggcgcgatgaaattgcgc
cagcgcggcgcgcagatttgggcgcaggacgaagccagcagcacgatttacggcatgccg
aaagcgattgccgaggccggcttggccgatcatgtttattctctggacgagattgcgaac
caatttaacaaactgcactga

DBGET integrated database retrieval system