Methylomonas sp. DH-1: AYM39_15955 Help Entry AYM39_15955       CDS       T04396                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mdh  Methylomonas sp. DH-1 Pathway mdh01100   Metabolic pathways mdh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mdh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AYM39_15955    00074 Mycolic acid biosynthesis     AYM39_15955   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AYM39_15955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding COS HTH_35 Motif Other DBs NCBI-ProteinID:  ANE56521 UniProt:  A0A172UB27 LinkDB All DBs Position complement(3592420..3592656) Genome browser AA seq 78 aa AA seqDB search MENMMSMAVYLVIADTLDIDVDEIYPDSNLKQDLGMTSAVQHELDQSIMEMFNNFQVDFS RANTVRDVVQQIAKVTVH NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaaatatgatgtccatggcggtttatttggtgatcgccgacacattggatatcgat gtcgacgagatttaccccgacagcaacctgaagcaggatttaggtatgacatccgcggtt cagcacgaactggaccaatcgatcatggagatgtttaacaattttcaggtcgacttcagt cgggcgaataccgtgcgcgacgtggttcagcagatcgccaaagtgacagttcactga

DBGET integrated database retrieval system