Methylomonas sp. DH-1: AYM39_18175 Help Entry AYM39_18175       CDS       T04396                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism mdh  Methylomonas sp. DH-1 Pathway mdh02020   Two-component system mdh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:mdh00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AYM39_18175  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     AYM39_18175  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:mdh02035]     AYM39_18175 Bacterial motility proteins [BR:mdh02035]  Flagellar system   Flagellar assembly proteins    Others     AYM39_18175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM OapC Motif Other DBs NCBI-ProteinID:  ANE56911 UniProt:  A0A172UC69 LinkDB All DBs Position complement(4080643..4080948) Genome browser AA seq 101 aa AA seqDB search MAIESITGKPVTTSVPAKPGVKDAAEPKQRTESGVVTDTVEITATAQDIKTASAAGAATP VVNEDRVAAIKAAIQAGSYQVNAERVAAKMLQFDKQLPDST NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggctatcgaatcaatcaccggcaagcctgttacgacctcagtgcccgcaaaacctggg gttaaagatgcggctgagcctaaacaacggaccgagagcggtgtcgttaccgatactgtc gagatcaccgccactgcccaggatattaaaacggcgtcggccgccggcgctgcaacgccg gtggtcaacgaagaccgggtggcagcgataaaagcggcgatccaggctggcagctaccaa gtcaacgctgaacgcgtggcggcgaaaatgctgcaattcgataaacagttacccgacagt acatga

DBGET integrated database retrieval system