Methylomonas sp. DH-1: AYM39_19920 Help Entry AYM39_19920       CDS       T04396                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism mdh  Methylomonas sp. DH-1 Brite KEGG Orthology (KO) [BR:mdh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mdh03036]     AYM39_19920 Chromosome and associated proteins [BR:mdh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AYM39_19920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL FtsL_2 NusG_II Motif Other DBs NCBI-ProteinID:  ANE57219 UniProt:  A0A172UD24 LinkDB All DBs Position 4484737..4485009 Genome browser AA seq 90 aa AA seqDB search MVFARNILLTILVAALLISGIAVIYSKYQSRLLFIEIQKKEKELDDYEVEWGRLQLELTT LTEENRVEVEARSRLMLTLPAQDKIIYIKP NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggtatttgcacgaaacatcctgctaacgatattggtggcggcgctgctgatttccggc attgccgtcatttacagcaagtaccaatcgcgcctgctgtttatcgagatccaaaaaaag gaaaaagaactcgacgattacgaagtcgaatggggacgtttacaactggaattgaccacg ctgaccgaagaaaaccgggttgaagtcgaagccagatcgcggctaatgctgaccctgccg gcgcaagacaaaattatatacatcaagccgtaa

DBGET integrated database retrieval system