Methylorubrum extorquens DM4: METDI0530 Help Entry METDI0530         CDS       T00947                                  Symbol acpP Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism mdi  Methylorubrum extorquens DM4 Pathway mdi01100   Metabolic pathways mdi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mdi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     METDI0530 (acpP)    00074 Mycolic acid biosynthesis     METDI0530 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     METDI0530 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 TerB DUF5783 DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  CAX22187 UniProt:  C7CAG2 LinkDB All DBs Position 493132..493368 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVEPEKVTEASNFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgccgagcgcgtgaagaagatcgtcgtcgagcacctgggcgtcgagcct gagaaggtcaccgaggcctccaacttcatcgacgatctcggcgccgacagcctcgacacc gtcgagctggtgatggcgttcgaggaggagttcaacgtcgagattccggacgacgcggcc gagaccattcagacggtcggtgacgcgatcaagttcctggaaaagaactccgcctga

DBGET integrated database retrieval system