KEGG   Microplitis demolitor: 106693066
Entry
106693066         CDS       T05600                                 
Name
(RefSeq) cytochrome P450 306a1-like
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
mdl  Microplitis demolitor
Pathway
mdl00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106693066
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mdl00199]
    106693066
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106693066
Cytochrome P450 [BR:mdl00199]
 Cytochrome P450, animal type
  CYP306 family
   106693066
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106693066
NCBI-ProteinID: XP_014297900
LinkDB
Position
Unknown
AA seq 370 aa
MIKYGPKRDIMEIKIRELTNEAIQKLKDKSIINVKNGIDPIEILHNCIGNIMNNLVFGKV
YNENDEIWKWLRELQEEGVKHIGVAGALNFLPFLKYIPYYKNLMKSLIDGKLKTHKYYRK
LIDEYKYKNNLNNDNDDNFLAAFYNEMTKRQNNNSDNNVGSFTEQQYYHLLADIFGAGTD
TTLTTIRWFLLYMAILPNQQEKIYQEIKTIVGNKQEITLEDSCSLILLQASICEIQRLKT
VVPVGIPHGAIVDDKIGDYDIPKGAMIIPLQWAIHMNPNYWENPNEFIPERFISPDGFLI
KPCAFIPFQTGKRMCVGDELAKMIMIIFISTIIKEFKISIPSDDEPIDLNGDCGITLVPK
NYKLTFIARQ
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgattaaatacggaccaaaaagagatattatggaaataaaaataagagaattgacaaat
gaagctatacaaaaattgaaagataagtcaataattaatgttaaaaatggaattgatcca
atagaaattttacataattgtattggtaacataatgaataatttagtatttggaaaagtt
tataatgaaaacgatgaaatttggaaatggctacgtgaattacaagaagaaggagttaaa
catattggagtcgcaggtgctttaaattttttgccatttttaaaatacataccttattat
aaaaatttaatgaaatcacttattgatggaaaattaaaaactcacaagtattatcgtaag
ttaattgatgaatacaaatataaaaataatttaaataatgataatgatgataattttctt
gcggcattttacaatgaaatgacaaaaagacaaaacaataatagtgataataatgttggt
tcatttactgaacaacagtattatcatttattagctgatatttttggtgctggtacagat
acaactttaactacaatacgttggtttttactttatatggctattttaccgaatcaacag
gaaaaaatttatcaagaaataaaaacaattgtaggaaataaacaagaaataactctggaa
gatagttgttctttaatattactacaggctagtatttgtgaaattcaaagattaaaaaca
gttgttcctgtaggtataccacatggtgctattgtagatgataaaataggtgattatgat
atacctaaaggtgcaatgattattccattacaatgggcaattcatatgaatccaaattat
tgggaaaatccaaatgaatttattcctgaaagatttatttcaccagatggatttttaatt
aaaccgtgtgcttttattcctttccaaactggtaaaagaatgtgtgttggagatgaatta
gctaaaatgattatgattatttttatttccacaattattaaagaatttaaaatatctatt
cccagtgacgatgaacctatcgatttaaatggtgattgtggaataactctagttccgaaa
aattataaactaacgtttatagctcgacaataa

DBGET integrated database retrieval system