Methylomonas denitrificans: JT25_006045 Help Entry JT25_006045       CDS       T04191                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mdn  Methylomonas denitrificans Pathway mdn01100   Metabolic pathways mdn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mdn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JT25_006045    00074 Mycolic acid biosynthesis     JT25_006045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JT25_006045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMK76057 UniProt:  A0A126T1V4 LinkDB All DBs Position 1300330..1300587 Genome browser AA seq 85 aa AA seqDB search MSEMETELKHLIIDTLALEDVDVADIDSNAALFNDGLGLDSIDALELGLAIRKKYQVKID AEHDDVIKIFASVAALAEYIESVRN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgagatggaaactgaattaaaacacctgattatcgacacgctggcgctggaagat gtcgatgtggcggatatagacagcaatgccgcgctgttcaatgacggcttgggcctggac tcgatagacgccctggagctggggttggcgatacgcaaaaagtatcaggtaaaaatcgat gccgagcatgatgacgtgataaaaatcttcgcttcggtggcggccttggctgaatatatc gaatccgtccgcaattga

DBGET integrated database retrieval system