KEGG   Monodelphis domestica (gray short-tailed opossum): 100016794
Entry
100016794         CDS       T01031                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo04610  Complement and coagulation cascades
mdo04810  Regulation of actin cytoskeleton
mdo05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100016794 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100016794 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100016794 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mdo04515]
    100016794 (ITGAX)
   04090 CD molecules [BR:mdo04090]
    100016794 (ITGAX)
Cell adhesion molecules [BR:mdo04515]
 Integrins
  Integrin alpha subunits
   100016794 (ITGAX)
CD molecules [BR:mdo04090]
 Proteins
  100016794 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 Copine
Other DBs
NCBI-GeneID: 100016794
NCBI-ProteinID: XP_007498040
Ensembl: ENSMODG00000002512
UniProt: F7B8W6
LinkDB
Position
6:complement(26634454..26673020)
AA seq 1166 aa
MMSAALFLLIALASSDAFNLDTEYPTIFQADGAEFGHTVVLYEGSRLVVGAPLERTSFNQ
TGQLYNCEYGIRNCEPIPMHIPPEAVDMSLGLSLTASTKPSQILACGPTIHQACGVNTYM
KGFCFVLNSNLQQRQKYPAALQKCPKQDTDIAFLIDGSGSISSSDFQKMKNFVKAMISQF
EKPSTQFSLMQFASNFKIHFTFEKFKNSHDPRRLVDEITQLSGVTKTASGIKKVINELFQ
KTRGARQYATKILIVITDGEKYDDPLEYSQVIPTAEKAGIIRYAIGVGEAFERPSSRQEL
EEIASEPSKDHIFWVDNFGALSNIQNQLKEKIFAIEGTQSRDSISFQHEMSQEGFSVAVT
PEGPALGAVGSFDWSGGVFLYSLTGSSTYIKASSEDKDMNDAYLGYATEAFIWNIAPSLV
LGAPRYQHVGKVVLFINRRGTWEQKAEVKGTQIGSYFGATLCPVDVNRDSNTDLILIGAP
HYYEQNHGGQVSICVLPVQKAKWQCNNILRGQQGHPFGRFGAALAVLGDINGDKLTDVAV
GAPGEEENHGAIYVFHGVFGFSINPSYSQRISGSVLSPTLQYFGQSLSGGQDVTQDGLMD
VAVGAHGQVLLFRTQPVLNVKVSIEFMPMELARSVYDCQKQEATNIEAGSATVCLNIKKI
IQDRLGDIQSSVSYDLALDPGRLSPRAIFDETKNRILKRVKTLKLGDHCENVKLLLPECV
EDSVTPIVLRFNFSLEGIPIDLSGNLRPVLAMGSQNHFTEALPFEKNCGEDHICKDDLSV
IFSYPGLQTLLVGHSLELDVEVTVSNQGEDSYRTVVTFEYPPGLSYRRVSVTQISMHQRL
SFRLTCDSAVVSDSENLRSSSCNINHPIFRMGAKITFIATFDVSPTANLGDQILIKATVS
SENNMPMTSKNVFQLKLPVKYATYVVIRSIEDSTKYLNFSVSEMNQSNITEYKYRVNNLG
QRDLPVHINFWVPMELNKVSVWNLTEIIIHPQDSSINCAQEIKEPSHSDFLTHIQKTPVL
NCSIAVCLKIICDIPTFNIQEELLFTIKGNLTFDWVSQTLQKKLSFMSSADIIFNELKYS
QLPGQEAFLRTQIETVVEQYKIHDPIPLILGSTVGGLLLLALITTALYKLGFFKRQYKNM
MKDEAEDVALKEESGPTAPSATATLS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgatgtctgctgcccttttcctgctaatagctctggcctcttctgatgcattcaacctg
gacacggaatatcctacaattttccaggcagatggagctgagtttgggcatactgtggtc
ctgtatgagggttctcgcttggtggtaggagccccgctggagaggacatcctttaaccag
actggccaactctacaactgtgaatatggcatcaggaattgtgagcccatccccatgcac
atccctccagaggcagtggatatgtccctggggctttctctaacagctagtacaaagcct
tcacagattctggcctgtggacccacaatacaccaagcctgtggggtgaacacgtatatg
aaaggtttctgttttgtgttgaattcaaacctgcagcaacgtcagaagtacccagcagcc
ctacaaaagtgtcccaaacaggacactgatattgccttcctgattgatggctctggaagc
atttcttcttctgacttccagaaaatgaaaaactttgtaaaagctatgataagtcagttt
gaaaaacccagcacacagttttccctgatgcagtttgcaagcaatttcaaaatacatttc
acatttgaaaaattcaagaacagtcatgatcctagaagactggtggacgaaattactcaa
ctgagtggagtgacaaaaactgcctcaggcatcaaaaaagtcataaatgaactctttcag
aaaacacgtggagcacggcaatacgccactaagatcctcatcgtcatcacggatggagag
aaatatgatgaccccttggaatatagtcaagtcatccctacagcagagaaagctggaata
atcagatatgcaattggggtgggagaggcctttgaacgtccatcctccagacaagaacta
gaagaaatagcatcagaaccctcaaaggatcacatattctgggttgacaactttggagca
ctcagcaacattcaaaaccagctaaaagaaaagatctttgccattgagggtactcagtcc
agggacagtatctccttccagcatgaaatgtctcaggagggcttcagtgtggcagtcaca
ccggaagggccagcccttggagccgtgggaagctttgactggtcagggggcgtcttcttg
tactccctaactggatcctccacctatatcaaggcatccagtgaggataaggacatgaac
gatgcttacctgggttatgctactgaagcattcatttggaatattgctccaagtcttgtc
ctgggagccccccgataccagcacgtagggaaggtcgtgctcttcatcaatagacgtgga
acctgggaacagaaggctgaggtcaaagggacacagattggctcctattttggggccaca
ctctgtcctgtggatgtcaacagagatagcaacactgacctgatcctcattggagctccc
cattactatgaacagaaccatggaggccaggtgtccatctgcgtattacctgttcagaag
gccaaatggcagtgtaacaacattcttcgagggcagcaaggacacccctttggacgtttt
ggagcagcattggctgtgctgggggatataaatggagataagttaacagatgtggctgtg
ggggcaccaggggaggaagaaaaccatggcgctatctatgtgtttcatggagtgtttgga
tttagcatcaacccttcctatagccagagaatcagtggctccgtcctttctcccacactc
cagtattttggtcagtcactgagtgggggacaagacgtcacccaggatggactcatggat
gtggcagtaggggcccacggacaggtcctgctcttcaggacacagccagtattgaatgtt
aaagtgtccatagagtttatgccaatggaattggcaaggtctgtgtatgactgccagaaa
caggaggccaccaacatagaagcagggagtgccactgtctgtctcaatatcaaaaaaatt
attcaagacaggctaggtgatatccagagttctgtgagttatgacctggccctggacccc
ggacgcctaagtcctcgtgccatctttgatgagacaaagaaccggatactaaaacgagtt
aaaaccctgaaattgggggatcactgtgagaatgtgaagctgctgttgccggaatgcgtg
gaggactcagtgactcccattgttctgcgtttcaacttttctctggagggaatacccatc
gatctttctggaaacctccgacctgttctagcaatgggctctcagaaccacttcacagaa
gctctcccttttgaaaaaaattgtggtgaggatcacatttgtaaagatgatctcagtgtc
attttcagttatcctgggctgcagaccctgttggtggggcattcgctggagctggatgtt
gaagtgacagtgagtaaccagggggaggactcttacaggactgtggtcaccttcgaatat
cccccaggactgtcctatcggcgagtgtcagtgacccagatctcaatgcatcagcggctt
tctttccgtctgacttgtgattcggcagtggtctcagactcagagaatctgagaagcagc
agctgtaacatcaaccatccaatcttccgaatgggagcaaagatcaccttcatagcgaca
ttcgatgtgtcccctacagccaatcttggggaccagatactcatcaaagccaccgtgagc
agtgagaacaacatgcctatgaccagtaaaaatgtcttccagctgaaactaccagtgaaa
tatgccacctacgtggtgattaggagcattgaagattctaccaaatatctcaacttctca
gtttcagaaatgaatcaaagtaacatcactgagtacaaataccgagtgaataacctggga
cagagggaccttcctgtccatatcaacttctgggtccccatggaattgaataaggtgtct
gtgtggaacttgactgagatcatcattcacccccaggattcctcaattaattgtgcccaa
gaaattaaagaacccagtcactctgacttcctgacacacattcagaagaccccagtgctg
aactgctccattgctgtctgcttgaaaattatctgtgatatccccaccttcaacatccaa
gaggagttactcttcaccattaaaggcaatttgacctttgactgggtcagccagactctg
cagaagaagctatcgttcatgagttcagctgacattattttcaatgaattgaagtattcc
cagcttccgggacaagaggcctttttaagaacccagatagagacagtggtggaacaatat
aagatccatgaccccatccccctcattttggggagcaccgtagggggactcctgctgctg
gctctcatcacaaccgcactgtataagcttggtttcttcaaacgtcagtataagaacatg
atgaaagatgaagctgaagatgttgctctgaaagaagaatccggacccacagctcccagt
gcaacagccacactctcctag

DBGET integrated database retrieval system