KEGG   Monodelphis domestica (gray short-tailed opossum): 100022523
Entry
100022523         CDS       T01031                                 
Name
(RefSeq) GTPase NRas-like
  KO
K07828  GTPase NRas
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo01522  Endocrine resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04062  Chemokine signaling pathway
mdo04068  FoxO signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04137  Mitophagy - animal
mdo04140  Autophagy - animal
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04218  Cellular senescence
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04371  Apelin signaling pathway
mdo04540  Gap junction
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04625  C-type lectin receptor signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04714  Thermogenesis
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04730  Long-term depression
mdo04810  Regulation of actin cytoskeleton
mdo04910  Insulin signaling pathway
mdo04912  GnRH signaling pathway
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04917  Prolactin signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04926  Relaxin signaling pathway
mdo04929  GnRH secretion
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04935  Growth hormone synthesis, secretion and action
mdo05010  Alzheimer disease
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05034  Alcoholism
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05163  Human cytomegalovirus infection
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05170  Human immunodeficiency virus 1 infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05207  Chemical carcinogenesis - receptor activation
mdo05208  Chemical carcinogenesis - reactive oxygen species
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05230  Central carbon metabolism in cancer
mdo05231  Choline metabolism in cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100022523
   04012 ErbB signaling pathway
    100022523
   04014 Ras signaling pathway
    100022523
   04015 Rap1 signaling pathway
    100022523
   04370 VEGF signaling pathway
    100022523
   04371 Apelin signaling pathway
    100022523
   04068 FoxO signaling pathway
    100022523
   04072 Phospholipase D signaling pathway
    100022523
   04071 Sphingolipid signaling pathway
    100022523
   04151 PI3K-Akt signaling pathway
    100022523
   04150 mTOR signaling pathway
    100022523
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100022523
   04137 Mitophagy - animal
    100022523
  09143 Cell growth and death
   04210 Apoptosis
    100022523
   04218 Cellular senescence
    100022523
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100022523
   04550 Signaling pathways regulating pluripotency of stem cells
    100022523
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100022523
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100022523
   04650 Natural killer cell mediated cytotoxicity
    100022523
   04660 T cell receptor signaling pathway
    100022523
   04662 B cell receptor signaling pathway
    100022523
   04664 Fc epsilon RI signaling pathway
    100022523
   04062 Chemokine signaling pathway
    100022523
  09152 Endocrine system
   04910 Insulin signaling pathway
    100022523
   04929 GnRH secretion
    100022523
   04912 GnRH signaling pathway
    100022523
   04915 Estrogen signaling pathway
    100022523
   04917 Prolactin signaling pathway
    100022523
   04921 Oxytocin signaling pathway
    100022523
   04926 Relaxin signaling pathway
    100022523
   04935 Growth hormone synthesis, secretion and action
    100022523
   04919 Thyroid hormone signaling pathway
    100022523
   04916 Melanogenesis
    100022523
  09156 Nervous system
   04725 Cholinergic synapse
    100022523
   04726 Serotonergic synapse
    100022523
   04720 Long-term potentiation
    100022523
   04730 Long-term depression
    100022523
   04722 Neurotrophin signaling pathway
    100022523
  09158 Development and regeneration
   04360 Axon guidance
    100022523
  09149 Aging
   04211 Longevity regulating pathway
    100022523
   04213 Longevity regulating pathway - multiple species
    100022523
  09159 Environmental adaptation
   04714 Thermogenesis
    100022523
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100022523
   05206 MicroRNAs in cancer
    100022523
   05205 Proteoglycans in cancer
    100022523
   05207 Chemical carcinogenesis - receptor activation
    100022523
   05208 Chemical carcinogenesis - reactive oxygen species
    100022523
   05203 Viral carcinogenesis
    100022523
   05230 Central carbon metabolism in cancer
    100022523
   05231 Choline metabolism in cancer
    100022523
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100022523
  09162 Cancer: specific types
   05210 Colorectal cancer
    100022523
   05225 Hepatocellular carcinoma
    100022523
   05226 Gastric cancer
    100022523
   05214 Glioma
    100022523
   05216 Thyroid cancer
    100022523
   05221 Acute myeloid leukemia
    100022523
   05220 Chronic myeloid leukemia
    100022523
   05218 Melanoma
    100022523
   05211 Renal cell carcinoma
    100022523
   05219 Bladder cancer
    100022523
   05215 Prostate cancer
    100022523
   05213 Endometrial cancer
    100022523
   05224 Breast cancer
    100022523
   05223 Non-small cell lung cancer
    100022523
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100022523
   05170 Human immunodeficiency virus 1 infection
    100022523
   05161 Hepatitis B
    100022523
   05160 Hepatitis C
    100022523
   05163 Human cytomegalovirus infection
    100022523
   05167 Kaposi sarcoma-associated herpesvirus infection
    100022523
   05165 Human papillomavirus infection
    100022523
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100022523
   05022 Pathways of neurodegeneration - multiple diseases
    100022523
  09165 Substance dependence
   05034 Alcoholism
    100022523
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100022523
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100022523
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100022523
   01522 Endocrine resistance
    100022523
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100022523
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100022523
   04031 GTP-binding proteins [BR:mdo04031]
    100022523
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100022523
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100022523
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100022523
  Exosomal proteins of other body fluids (saliva and urine)
   100022523
  Exosomal proteins of breast cancer cells
   100022523
  Exosomal proteins of colorectal cancer cells
   100022523
GTP-binding proteins [BR:mdo04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100022523
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf MMR_HSR1
Other DBs
NCBI-GeneID: 100022523
NCBI-ProteinID: XP_007495704
Ensembl: ENSMODG00000019076
LinkDB
Position
5:18210630..18212652
AA seq 190 aa
MLYKLVVMGSCKVGKSALTIQLVKNCFVPDYDPTIEDSYHTQLVVDGEPCQLDIVDTTGS
EEYQSHRQEFMRRGQGFLCVYAVDDIKSFVDVNIFLDQLRRIRDTDRVPLVLVANKTDKA
DCLVTRELGQEAARSFRVPFVETSAKTRPSVERAFGELVREIRRFSVQELRHRRDAEHDR
GCGFTPCHIM
NT seq 573 nt   +upstreamnt  +downstreamnt
atgctgtacaaattggtggtgatgggcagctgtaaagtgggcaagagtgccctgaccatc
cagctggtcaagaactgctttgtccccgactacgaccccaccatcgaagactcctaccac
acccagctggtggtggacggggagccctgccagctggacatcgtggacaccaccggcagc
gaggagtaccagtcccaccggcaggagttcatgcggcgagggcagggcttcctctgcgtc
tatgccgtggacgacatcaagtcctttgtagacgtgaacatcttcttggaccagctgcgc
aggatcagagacaccgaccgcgttcccctggtcctggtggccaacaagaccgacaaggcc
gactgcctggtgacccgggagctgggccaggaggcagccagaagcttcagggtgcccttt
gtggagacctcggccaagacccggcccagcgtggagcgcgcctttggggagctggtgcgg
gagatccgccgcttcagcgtccaggagctcaggcaccgccgggatgctgagcatgaccgg
ggctgcggcttcacaccttgccacatcatgtga

DBGET integrated database retrieval system