KEGG   Monodelphis domestica (gray short-tailed opossum): 554197
Entry
554197            CDS       T01031                                 
Symbol
NRAS, N-ras
Name
(RefSeq) neuroblastoma RAS viral oncogene homolog
  KO
K07828  GTPase NRas
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo01522  Endocrine resistance
mdo04010  MAPK signaling pathway
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04062  Chemokine signaling pathway
mdo04068  FoxO signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04137  Mitophagy - animal
mdo04140  Autophagy - animal
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04210  Apoptosis
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04218  Cellular senescence
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04371  Apelin signaling pathway
mdo04540  Gap junction
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04625  C-type lectin receptor signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04714  Thermogenesis
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04725  Cholinergic synapse
mdo04726  Serotonergic synapse
mdo04730  Long-term depression
mdo04810  Regulation of actin cytoskeleton
mdo04910  Insulin signaling pathway
mdo04912  GnRH signaling pathway
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04917  Prolactin signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04926  Relaxin signaling pathway
mdo04929  GnRH secretion
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04935  Growth hormone synthesis, secretion and action
mdo05010  Alzheimer disease
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05034  Alcoholism
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05163  Human cytomegalovirus infection
mdo05165  Human papillomavirus infection
mdo05166  Human T-cell leukemia virus 1 infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05170  Human immunodeficiency virus 1 infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05206  MicroRNAs in cancer
mdo05207  Chemical carcinogenesis - receptor activation
mdo05208  Chemical carcinogenesis - reactive oxygen species
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05216  Thyroid cancer
mdo05218  Melanoma
mdo05219  Bladder cancer
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05230  Central carbon metabolism in cancer
mdo05231  Choline metabolism in cancer
mdo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mdo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    554197 (NRAS)
   04012 ErbB signaling pathway
    554197 (NRAS)
   04014 Ras signaling pathway
    554197 (NRAS)
   04015 Rap1 signaling pathway
    554197 (NRAS)
   04370 VEGF signaling pathway
    554197 (NRAS)
   04371 Apelin signaling pathway
    554197 (NRAS)
   04068 FoxO signaling pathway
    554197 (NRAS)
   04072 Phospholipase D signaling pathway
    554197 (NRAS)
   04071 Sphingolipid signaling pathway
    554197 (NRAS)
   04151 PI3K-Akt signaling pathway
    554197 (NRAS)
   04150 mTOR signaling pathway
    554197 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    554197 (NRAS)
   04137 Mitophagy - animal
    554197 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    554197 (NRAS)
   04218 Cellular senescence
    554197 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    554197 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    554197 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    554197 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    554197 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    554197 (NRAS)
   04660 T cell receptor signaling pathway
    554197 (NRAS)
   04662 B cell receptor signaling pathway
    554197 (NRAS)
   04664 Fc epsilon RI signaling pathway
    554197 (NRAS)
   04062 Chemokine signaling pathway
    554197 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    554197 (NRAS)
   04929 GnRH secretion
    554197 (NRAS)
   04912 GnRH signaling pathway
    554197 (NRAS)
   04915 Estrogen signaling pathway
    554197 (NRAS)
   04917 Prolactin signaling pathway
    554197 (NRAS)
   04921 Oxytocin signaling pathway
    554197 (NRAS)
   04926 Relaxin signaling pathway
    554197 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    554197 (NRAS)
   04919 Thyroid hormone signaling pathway
    554197 (NRAS)
   04916 Melanogenesis
    554197 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    554197 (NRAS)
   04726 Serotonergic synapse
    554197 (NRAS)
   04720 Long-term potentiation
    554197 (NRAS)
   04730 Long-term depression
    554197 (NRAS)
   04722 Neurotrophin signaling pathway
    554197 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    554197 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    554197 (NRAS)
   04213 Longevity regulating pathway - multiple species
    554197 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    554197 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    554197 (NRAS)
   05206 MicroRNAs in cancer
    554197 (NRAS)
   05205 Proteoglycans in cancer
    554197 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    554197 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    554197 (NRAS)
   05203 Viral carcinogenesis
    554197 (NRAS)
   05230 Central carbon metabolism in cancer
    554197 (NRAS)
   05231 Choline metabolism in cancer
    554197 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    554197 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    554197 (NRAS)
   05225 Hepatocellular carcinoma
    554197 (NRAS)
   05226 Gastric cancer
    554197 (NRAS)
   05214 Glioma
    554197 (NRAS)
   05216 Thyroid cancer
    554197 (NRAS)
   05221 Acute myeloid leukemia
    554197 (NRAS)
   05220 Chronic myeloid leukemia
    554197 (NRAS)
   05218 Melanoma
    554197 (NRAS)
   05211 Renal cell carcinoma
    554197 (NRAS)
   05219 Bladder cancer
    554197 (NRAS)
   05215 Prostate cancer
    554197 (NRAS)
   05213 Endometrial cancer
    554197 (NRAS)
   05224 Breast cancer
    554197 (NRAS)
   05223 Non-small cell lung cancer
    554197 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    554197 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    554197 (NRAS)
   05161 Hepatitis B
    554197 (NRAS)
   05160 Hepatitis C
    554197 (NRAS)
   05163 Human cytomegalovirus infection
    554197 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    554197 (NRAS)
   05165 Human papillomavirus infection
    554197 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    554197 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    554197 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    554197 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    554197 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    554197 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    554197 (NRAS)
   01522 Endocrine resistance
    554197 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    554197 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    554197 (NRAS)
   04031 GTP-binding proteins [BR:mdo04031]
    554197 (NRAS)
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    554197 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    554197 (NRAS)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   554197 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   554197 (NRAS)
  Exosomal proteins of breast cancer cells
   554197 (NRAS)
  Exosomal proteins of colorectal cancer cells
   554197 (NRAS)
GTP-binding proteins [BR:mdo04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    554197 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 554197
NCBI-ProteinID: NP_001028161
Ensembl: ENSMODG00000004590
UniProt: Q95ME4
LinkDB
Position
2:complement(485794069..485802840)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CLGLSCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggagctggcggtgtggggaaaagcgccttgacc
atccagctcatccagaatcactttgtagacgagtatgatcctacgatagaggactcttat
cgaaagcaagtagttattgatggtgaaacctgtttgttggacatactcgacacagctgga
caggaagagtacagtgctatgagagaccagtatatgaggacaggcgaaggctttctctgt
gtgtttgccatcaacaatagcaaatcatttgcagatataaacctctacagggaacaaatt
aaacgagtgaaagactctgatgatgtgcctatggtgctggtgggaaataagtgtgatttg
ccaacaaggacagttgacacaaaacaagctcatgaactagccaaaagctatggaattccc
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgacagtaccgcatgaaaaaactcaacagtagcgacgatgggactcaaggt
tgtctaggtctctcgtgtgcagtcatgtaa

DBGET integrated database retrieval system