Myotis daubentonii (Daubenton's bat): 132212149 Help Entry 132212149         CDS       T10294                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04814   Motor proteins mdt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mdt00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     132212149  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132212149  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mdt03037]     132212149    04812 Cytoskeleton proteins [BR:mdt04812]     132212149 Cilium and associated proteins [BR:mdt03037]  Motile cilia and associated proteins   Dynein arm    132212149 Cytoskeleton proteins [BR:mdt04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      132212149 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  132212149 NCBI-ProteinID:  XP_059513333 LinkDB All DBs Position 11:complement(53566283..53566999) Genome browser AA seq 113 aa AA seqDB search MEDYQTAEETTFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCIIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccagactgcggaagagaccacttttgttgttgacgaagtgagcaacatt gtgaaagaggctatagaaagtgccatcggtggcaacgcctatcagcacagcaaagtcaat cagtggaccacaaatgtcgtagaacaaactctaagccaactcaccaagctgggaaaacca ttcaaatacattgtgacctgtataattatgcagaagaacggagcaggactacacacggcg agttcttgcttctgggacagctctactgacgggagctgcaccgtgcgatgggagaataag accatgtactgcatcgtcagcgccttcggactgtccatctga

DBGET integrated database retrieval system