Myotis daubentonii (Daubenton's bat): 132212793 Help Entry 132212793         CDS       T10294                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04010   MAPK signaling pathway mdt04020   Calcium signaling pathway mdt04022   cGMP-PKG signaling pathway mdt04114   Oocyte meiosis mdt04218   Cellular senescence mdt04310   Wnt signaling pathway mdt04360   Axon guidance mdt04370   VEGF signaling pathway mdt04380   Osteoclast differentiation mdt04625   C-type lectin receptor signaling pathway mdt04650   Natural killer cell mediated cytotoxicity mdt04658   Th1 and Th2 cell differentiation mdt04659   Th17 cell differentiation mdt04660   T cell receptor signaling pathway mdt04662   B cell receptor signaling pathway mdt04720   Long-term potentiation mdt04724   Glutamatergic synapse mdt04921   Oxytocin signaling pathway mdt04922   Glucagon signaling pathway mdt04924   Renin secretion mdt05010   Alzheimer disease mdt05014   Amyotrophic lateral sclerosis mdt05020   Prion disease mdt05022   Pathways of neurodegeneration - multiple diseases mdt05031   Amphetamine addiction mdt05152   Tuberculosis mdt05163   Human cytomegalovirus infection mdt05166   Human T-cell leukemia virus 1 infection mdt05167   Kaposi sarcoma-associated herpesvirus infection mdt05170   Human immunodeficiency virus 1 infection mdt05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mdt05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132212793 (PPP3R2)    04310 Wnt signaling pathway     132212793 (PPP3R2)    04370 VEGF signaling pathway     132212793 (PPP3R2)    04020 Calcium signaling pathway     132212793 (PPP3R2)    04022 cGMP-PKG signaling pathway     132212793 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     132212793 (PPP3R2)    04218 Cellular senescence     132212793 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132212793 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     132212793 (PPP3R2)    04660 T cell receptor signaling pathway     132212793 (PPP3R2)    04658 Th1 and Th2 cell differentiation     132212793 (PPP3R2)    04659 Th17 cell differentiation     132212793 (PPP3R2)    04662 B cell receptor signaling pathway     132212793 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     132212793 (PPP3R2)    04921 Oxytocin signaling pathway     132212793 (PPP3R2)    04924 Renin secretion     132212793 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     132212793 (PPP3R2)    04720 Long-term potentiation     132212793 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     132212793 (PPP3R2)    04380 Osteoclast differentiation     132212793 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     132212793 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132212793 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     132212793 (PPP3R2)    05163 Human cytomegalovirus infection     132212793 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     132212793 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     132212793 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     132212793 (PPP3R2)    05014 Amyotrophic lateral sclerosis     132212793 (PPP3R2)    05020 Prion disease     132212793 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     132212793 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     132212793 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132212793 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mdt01009]     132212793 (PPP3R2) Protein phosphatases and associated proteins [BR:mdt01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132212793 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  132212793 NCBI-ProteinID:  XP_059514764 LinkDB All DBs Position 11:complement(57861803..57862657) Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEMGSRFDHEEIKRLSKRFRKLDLDSSGALSLDELLSLPDLWNNPLAQRVFE VFDADGDGKVDFEEFIVGTSLFSVRGDEEQKLRFAFSIYDMDRDGYISNGELFQVLKMMV GNNLQDRELQQIVDKTIIILDRDGDGRLSFEEFKVAVQDLEIHKQLVVEV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggccagctaccccgaggagatgggctcccgctttgaccacgaggagatt aagaggctgagcaagaggttcaggaagctggacctggactcctcgggcgccctgagcttg gacgagctcctgtccctgcccgacctgtggaacaacccgctggcgcagcgagtgttcgag gtcttcgacgccgacggcgacggcaaggtggacttcgaggagttcatcgtggggacctcc ctgttcagcgtccggggggacgaggagcagaagctgcggttcgctttcagcatctacgac atggatagggacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg gggaacaacttgcaggaccgggagctgcagcagatcgtggacaaaaccatcatcatcctg gacagggacggcgacgggagactctccttcgaagagttcaaagtcgccgtgcaggacctg gagatccacaagcagctggtggtggaggtgtga

DBGET integrated database retrieval system