Myotis daubentonii (Daubenton's bat): 132212793 Help Entry 132212793         CDS       T10294                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04010   MAPK signaling pathway mdt04020   Calcium signaling pathway mdt04022   cGMP-PKG signaling pathway mdt04114   Oocyte meiosis mdt04218   Cellular senescence mdt04310   Wnt signaling pathway mdt04360   Axon guidance mdt04370   VEGF signaling pathway mdt04380   Osteoclast differentiation mdt04625   C-type lectin receptor signaling pathway mdt04650   Natural killer cell mediated cytotoxicity mdt04658   Th1 and Th2 cell differentiation mdt04659   Th17 cell differentiation mdt04660   T cell receptor signaling pathway mdt04662   B cell receptor signaling pathway mdt04720   Long-term potentiation mdt04724   Glutamatergic synapse mdt04921   Oxytocin signaling pathway mdt04922   Glucagon signaling pathway mdt04924   Renin secretion mdt05010   Alzheimer disease mdt05014   Amyotrophic lateral sclerosis mdt05020   Prion disease mdt05022   Pathways of neurodegeneration - multiple diseases mdt05031   Amphetamine addiction mdt05152   Tuberculosis mdt05163   Human cytomegalovirus infection mdt05166   Human T-cell leukemia virus 1 infection mdt05167   Kaposi sarcoma-associated herpesvirus infection mdt05170   Human immunodeficiency virus 1 infection mdt05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mdt05417   Lipid and atherosclerosis Brite Protein phosphatases and associated proteins [BR:mdt01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132212793 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  132212793 NCBI-ProteinID:  XP_059514764 LinkDB All DBs Position 11:complement(57861803..57862657) Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEMGSRFDHEEIKRLSKRFRKLDLDSSGALSLDELLSLPDLWNNPLAQRVFE VFDADGDGKVDFEEFIVGTSLFSVRGDEEQKLRFAFSIYDMDRDGYISNGELFQVLKMMV GNNLQDRELQQIVDKTIIILDRDGDGRLSFEEFKVAVQDLEIHKQLVVEV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggccagctaccccgaggagatgggctcccgctttgaccacgaggagatt aagaggctgagcaagaggttcaggaagctggacctggactcctcgggcgccctgagcttg gacgagctcctgtccctgcccgacctgtggaacaacccgctggcgcagcgagtgttcgag gtcttcgacgccgacggcgacggcaaggtggacttcgaggagttcatcgtggggacctcc ctgttcagcgtccggggggacgaggagcagaagctgcggttcgctttcagcatctacgac atggatagggacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg gggaacaacttgcaggaccgggagctgcagcagatcgtggacaaaaccatcatcatcctg gacagggacggcgacgggagactctccttcgaagagttcaaagtcgccgtgcaggacctg gagatccacaagcagctggtggtggaggtgtga

DBGET integrated database retrieval system