Myotis daubentonii (Daubenton's bat): 132215861 Help Entry 132215861         CDS       T10294                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04014   Ras signaling pathway mdt04015   Rap1 signaling pathway mdt04022   cGMP-PKG signaling pathway mdt04024   cAMP signaling pathway mdt04062   Chemokine signaling pathway mdt04071   Sphingolipid signaling pathway mdt04072   Phospholipase D signaling pathway mdt04081   Hormone signaling mdt04144   Endocytosis mdt04150   mTOR signaling pathway mdt04270   Vascular smooth muscle contraction mdt04310   Wnt signaling pathway mdt04350   TGF-beta signaling pathway mdt04360   Axon guidance mdt04510   Focal adhesion mdt04520   Adherens junction mdt04530   Tight junction mdt04611   Platelet activation mdt04621   NOD-like receptor signaling pathway mdt04625   C-type lectin receptor signaling pathway mdt04660   T cell receptor signaling pathway mdt04670   Leukocyte transendothelial migration mdt04722   Neurotrophin signaling pathway mdt04810   Regulation of actin cytoskeleton mdt04921   Oxytocin signaling pathway mdt04928   Parathyroid hormone synthesis, secretion and action mdt04972   Pancreatic secretion mdt05100   Bacterial invasion of epithelial cells mdt05132   Salmonella infection mdt05133   Pertussis mdt05135   Yersinia infection mdt05152   Tuberculosis mdt05163   Human cytomegalovirus infection mdt05200   Pathways in cancer mdt05203   Viral carcinogenesis mdt05205   Proteoglycans in cancer mdt05206   MicroRNAs in cancer mdt05210   Colorectal cancer mdt05417   Lipid and atherosclerosis mdt05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     132215861 (RHOA)    04015 Rap1 signaling pathway     132215861 (RHOA)    04310 Wnt signaling pathway     132215861 (RHOA)    04350 TGF-beta signaling pathway     132215861 (RHOA)    04072 Phospholipase D signaling pathway     132215861 (RHOA)    04071 Sphingolipid signaling pathway     132215861 (RHOA)    04024 cAMP signaling pathway     132215861 (RHOA)    04022 cGMP-PKG signaling pathway     132215861 (RHOA)    04150 mTOR signaling pathway     132215861 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     132215861 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132215861 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     132215861 (RHOA)    04520 Adherens junction     132215861 (RHOA)    04530 Tight junction     132215861 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132215861 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     132215861 (RHOA)    04621 NOD-like receptor signaling pathway     132215861 (RHOA)    04625 C-type lectin receptor signaling pathway     132215861 (RHOA)    04660 T cell receptor signaling pathway     132215861 (RHOA)    04670 Leukocyte transendothelial migration     132215861 (RHOA)    04062 Chemokine signaling pathway     132215861 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     132215861 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     132215861 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     132215861 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     132215861 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     132215861 (RHOA)   09158 Development and regeneration    04360 Axon guidance     132215861 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132215861 (RHOA)    05206 MicroRNAs in cancer     132215861 (RHOA)    05205 Proteoglycans in cancer     132215861 (RHOA)    05203 Viral carcinogenesis     132215861 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     132215861 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     132215861 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     132215861 (RHOA)    05135 Yersinia infection     132215861 (RHOA)    05133 Pertussis     132215861 (RHOA)    05152 Tuberculosis     132215861 (RHOA)    05100 Bacterial invasion of epithelial cells     132215861 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132215861 (RHOA)    05418 Fluid shear stress and atherosclerosis     132215861 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mdt04131]     132215861 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mdt04147]     132215861 (RHOA)    04031 GTP-binding proteins [BR:mdt04031]     132215861 (RHOA) Membrane trafficking [BR:mdt04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     132215861 (RHOA) Exosome [BR:mdt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132215861 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    132215861 (RHOA)   Exosomal proteins of colorectal cancer cells    132215861 (RHOA)   Exosomal proteins of bladder cancer cells    132215861 (RHOA) GTP-binding proteins [BR:mdt04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     132215861 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  132215861 NCBI-ProteinID:  XP_059520720 LinkDB All DBs Position 14:58133592..58163831 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaattggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtttttagcaaggaccagttcccagaggtgtatgtgcctacggtgtttgag aactatgtggcagacatcgaagtggatggaaagcaggttgagttggctttgtgggacacg gccggacaggaggattatgatcgcttgaggcccctctcctacccggacacggatgtgatc ctgatgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtaaaa ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgctca gcaaagaccaaagacggagtgagggaggttttcgaaatggccacgagagctgctctgcag gccagacgtgggaagaagaaatccgggtgccttgttttgtga

DBGET integrated database retrieval system