Myotis daubentonii (Daubenton's bat): 132217879 Help Entry 132217879         CDS       T10294                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism mdt  Myotis daubentonii (Daubenton's bat) Pathway mdt04081   Hormone signaling mdt04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mdt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     132217879 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     132217879 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mdt04052]     132217879 (GAST) Cytokines and neuropeptides [BR:mdt04052]  Neuropeptides   GPCR binding    132217879 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  132217879 NCBI-ProteinID:  XP_059524287 LinkDB All DBs Position 16:50276825..50278723 Genome browser AA seq 104 aa AA seqDB search MQRLCVQALILALALAAFSEASWKPRSQLQDAPSGPGAKRALEARWPDQLGPAAHHQRQL RFPDPPHPVADLSKKQGPWLEEDEEAYGWMDFGRRSAEEGDQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcggctctgtgtgcaagcgctgatcctggctctggctctggccgccttctcggaa gcctcctggaagccccgctcccagctgcaggacgcaccctcaggcccaggggccaagagg gccctggaggcacgttggccggaccagctgggcccagccgctcaccaccaaaggcagctg aggttcccggatcccccgcacccggtggcagacctgtccaagaagcaggggccgtggctg gaggaagatgaagaagcgtatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacagccctag

DBGET integrated database retrieval system